Sulfotransferase 1A1

Product Name :
Sulfotransferase 1A1

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P52840

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:Sult1a1

Uniprot :
P52840

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
2-Hydroxyfluorene In Vitro Trastuzumab deruxtecan Autophagy PMID:34043764 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human CYP11B1 protein

Name : Recombinant Human CYP11B1 protein

Background :

Biological Activity :

Species :
Homo sapiens (Human)

Expression System :

Protein Accession :
P15538

Synonyms :
Recombinant Human CYP11B1 protein

Amino Acid Sequence :

Molecular Weight :
68.99 kDa

Purity :
>90% as determined by SDS-PAGE

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the human CYP11B1 (Gly134-Asn503) was fused with GST tag

Formulation :
Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4%Trehalose, 1% Mannitol.

Reconstitution :
Reconstitute in sterile water for a stock solution.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
477775-14-7 manufacturer 3483-12-3 MedChemExpress PMID:31082092 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Tubulin beta chain

Product Name :
Tubulin beta chain

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:Q767L7

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:TUBB

Uniprot :
Q767L7

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
NDUFA5 Antibody Description IL-13 Protein, HumanMedChemExpress PMID:34978952 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human REG3G protein

Name : Recombinant Human REG3G protein

Background :

Biological Activity :

Species :
Homo sapiens (Human)

Expression System :

Protein Accession :
Q6UW15

Synonyms :
Recombinant Human REG3G protein

Amino Acid Sequence :

Molecular Weight :
18.15 kDa

Purity :
>90% as determined by SDS-PAGE

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the human REG3G (Glu27-Asp175) was fused with His tag

Formulation :
Supplied as solution form in PBS pH 7.5 or lyophilized from PBS pH 7.5.

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
112809-51-5 web 50-81-7 IUPAC Name PMID:30000310 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Serine–pyruvate aminotransferase, mitochondrial

Product Name :
Serine–pyruvate aminotransferase, mitochondrial

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:O35423

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:Agxt

Uniprot :
O35423

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Cefuroxime Autophagy FGR Antibody Technical Information PMID:34994959 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Heterogeneous nuclear ribonucleoproteins A2/B1

Product Name :
Heterogeneous nuclear ribonucleoproteins A2/B1

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P22626

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:HNRNPA2B1

Uniprot :
P22626

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Actinin-α1 Antibody Formula TTF-1 Antibody In stock PMID:35196258 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Syndecan-2

Product Name :
Syndecan-2

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P34900

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:Sdc2

Uniprot :
P34900

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Encenicline Purity & Documentation Bafilomycin A1 custom synthesis PMID:34896309 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Properdin

Product Name :
Properdin

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P27918

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:CFP

Uniprot :
P27918

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Linoleic acid (Standard) Autophagy Iopamidol Epigenetics PMID:35265086 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-GST)

Product Name :
Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-GST)

Brief Description :

Accession No. :
P16410

Calculated MW :
39.2kDa

Target Sequence :
KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDGGGSMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
P16410

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
AFP Antibody manufacturer MMP13 Antibody MedChemExpress PMID:35133479 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

85/88 kDa calcium-independent phospholipase A2

Product Name :
85/88 kDa calcium-independent phospholipase A2

Brief Description :
Recombinant Protein

Accession No. :
Uniprot ID:P97819

Calculated MW :

Target Sequence :

Storage :
Store at -20˚C. (Avoid repeated freezing and thawing.)

Application Details :
Storage Buffer:50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)gene_full_name:Pla2g6

Uniprot :
P97819

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Anti-Mouse Ly-6G/Ly-6C Antibody Purity & Documentation GALE Antibody Epigenetic Reader Domain PMID:34718779 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Integrase Inhibitors hiv-integrase.com

Sulfotransferase 1A1

Recombinant Human CYP11B1 protein

Tubulin beta chain

Recombinant Human REG3G protein

Serine–pyruvate aminotransferase, mitochondrial

Heterogeneous nuclear ribonucleoproteins A2/B1

Syndecan-2

Properdin

Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-GST)

85/88 kDa calcium-independent phospholipase A2

You Missed

Sulfotransferase 1A1

Recombinant Human CYP11B1 protein

Tubulin beta chain

Recombinant Human REG3G protein