MAPK9 (Human) Recombinant Protein
Name : MAPK9 (Human) Recombinant ProteinBiological Activity : Human MAPK9 (NP_002743.3, 1 a.a. - 364 a.a.) partial recombinant protein with GST-tag at N-terminal using E.coli expression system and activated with…
Name : MAPK9 (Human) Recombinant ProteinBiological Activity : Human MAPK9 (NP_002743.3, 1 a.a. - 364 a.a.) partial recombinant protein with GST-tag at N-terminal using E.coli expression system and activated with…
Product Name : Rat DPP3 Protein 2032express system : E.coliProduct tag : N-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Dipeptidyl peptidase III (DPP3) is…
Name : Il27 (Mouse) Recombinant ProteinBiological Activity : Mouse Il27 (Q8K3I6) recombinant protein expressed in E.Coli.Tag : Protein Accession No. : Q8K3I6Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=246779Amino Acid Sequence : MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDSMolecular…
Product Name : PE-Labeled Human HLA-A*02:01&B2M&P53 R175H (HMTEVVRHC) Tetramer Protein 2477express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: p53…
Name : FMNL1 (Human) Recombinant Protein (Q01)Biological Activity : Human FMNL1 partial ORF ( NP_005883, 893 a.a. - 991 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Name : MAPK3 (Human) Recombinant ProteinBiological Activity : Human MAPK3 (NP_002737.1, 1 a.a. - 379 a.a.) full length recombinant protein with GST tag expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional…
Product Name : Biotinylated Human HLA-A*11:01&B2M&KRAS G12S (VVVGASGVGK) Monomer Protein 2716express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Kirsten…
Name : BMPR1B (Human) Recombinant Protein (Q03)Biological Activity : Human BMPR1B partial ORF ( AAH47773.1, 24 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Name : SIK2 (Human) Recombinant ProteinBiological Activity : Human SIK2 (NP_056006.1, 1 a.a. - 926 a.a.) full-length recombinant protein with GST tag expressed in baculovirus infected Sf21 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional…
Product Name : Mouse CD79B Protein 4064express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: CD79B (also known as B29,…
Name : Human IgG4 Fc Protein, Tag Free (MALS & SPR verified)Background : Immunoglobulin G4 (IgG4) is a member of many immunoglobulin G developed and secreted by effective B cells.…
Name : MAPK7 (Human) Recombinant ProteinBiological Activity : Human MAPK7 (NP_002740.2, 1 a.a. - 398 a.a.) partial recombinant protein with GST tag expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag…
Product Name : Mouse BAFFR/TNFRSF13C Protein 3594express system : HEK293Product tag : C-hFcPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: BAFF binds to three TNF…
Name : Human IL-1 RAcP / IL-1 R3 Protein, His Tag (MALS verified)Background : Interleukin-1 receptor accessory protein (IL1RAP or IL-1RAcP) is also known as Interleukin-1 receptor 3 (IL-1R-3 or…
Name : gp120 (CAP210.2.00) (HIV-1/Clade C) Recombinant ProteinBiological Activity : gp120 (CAP210.2.00) (HIV-1/Clade C) (DQ435683, 40 a.a. - 513 a.a.) partial recombinant protein with His tag expressed in 293 cells.Recombinant…
Name : FITC-Labeled Human VEGF R2 / KDR Protein, His TagBackground : Kinase insert domain receptor (KDR) is also known as CD309, FLK1, VEGFR, VEGFR2, and is one of the…
Name : NP (H5N1) (A/Indonesia/5/2005) Recombinant ProteinBiological Activity : NP (H5N1) (A/Indonesia/5/2005) (ABI36003) partial recombinant protein with His tag expressed in 293 cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant…
Product Name : Human NOGOR Protein 3980express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: NOGO Receptor 1 (RTN4R) regulates…
Name : LEP (Human) Recombinant ProteinBiological Activity : Human LEP (Q6NT58) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Result of activity analysisProtein Accession No. : Q6NT58Protein…
Product Name : Human Jagged 1/JAG1 Protein 2591express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGEBackground: JAGGED1 (JAG1) is composed of a relatively small intracellular…
Name : Human IL-13 R alpha 2 Protein, His Tag (MALS verified)Background : Interleukin-13 receptor subunit alpha-2 is also known as IL13Rα2, IL13Ra2 cluster of differentiation 213A2, CD213A2, CT19, IL-13R,…
Name : CCL13 (Human) Recombinant ProteinBiological Activity : Human CCL13 (Q99616) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Result of activity analysisProtein Accession No. : Q99616Protein…
Name : Rabbit M-CSF R / CSF1R / CD115 Protein, His TagBackground : Colony stimulating factor 1 receptor (CSF1R) is also known as macrophage colony-stimulating factor receptor (M-CSFR), CD115 Cluster…
Name : ELK4 (Human) Recombinant Protein (P01)Biological Activity : Human ELK4 full-length ORF ( NP_068567.1, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : Biotinylated Human CD155 / PVR Protein, Fc,Avitag™ (MALS verified)Background : CD155 is a Type I transmembrane glycoprotein in the immunoglobulin superfamily. Commonly known as Poliovirus Receptor (PVR) due…
Name : EGF (Human) Recombinant ProteinBiological Activity : Human EGF (P01133, 1 a.a. - 247 a.a.) full-length recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag…
Name : LOC644936 (Human) Recombinant Protein (P01)Biological Activity : Human LOC644936 full-length ORF ( AAH92424.1, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : FOXI2 (Human) Recombinant Protein (P01)Biological Activity : Human FOXI2 full-length ORF (BAC87649.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
Name : LOC387793 (Human) Recombinant Protein (P01)Biological Activity : Human LOC387793 full-length ORF ( AAH62331.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : CCL4L2 (Human) Recombinant Protein (Q01)Biological Activity : Human CCL4L2 partial ORF (NP_996890.1, 28 a.a. - 92 a.a.) recombinant protein with GST tag at N-terminal.Tag : Best use within…
Name : ZNF713 (Human) Recombinant Protein (P01)Biological Activity : Human ZNF713 full-length ORF ( AAI48833.1, 1 a.a. - 430 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : CNPY1 (Human) Recombinant Protein (P01)Biological Activity : Human CNPY1 full-length ORF (1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best use…
Name : E2F6 (Human) Recombinant Protein (P01)Biological Activity : Human E2F6 full-length ORF ( AAH08348, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : SLC39A12 (Human) Recombinant ProteinBiological Activity : Human SLC39A12 full-length ORF (ADR83097.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane ProteinsTag : Best…
Name : TMEM217 (Human) Recombinant ProteinBiological Activity : Human TMEM217 full-length ORF (ADZ15849.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane ProteinsTag : Best…
Name : LRRC55 (Human) Recombinant Protein (P01)Biological Activity : Human LRRC55 full-length ORF ( NP_001005210.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : ARID3A (Human) Recombinant Protein (P01)Biological Activity : Human ARID3A full-length ORF ( AAH60828.1, 1 a.a. - 593 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : C9orf97 (Human) Recombinant Protein (P01)Biological Activity : Human C9orf97 full-length ORF ( AAH35604.1, 1 a.a. - 489 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : CMC1 (Human) Recombinant Protein (P01)Biological Activity : Human CMC1 full-length ORF (AAH52644.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
Name : C15orf32 (Human) Recombinant Protein (P01)Biological Activity : Human C15orf32 full-length ORF (BAB71467.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
Name : NRSN1 (Human) Recombinant Protein (P01)Biological Activity : Human NRSN1 full-length ORF ( AAH23514.1, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : ADHFE1 (Human) Recombinant Protein (Q01)Biological Activity : Human ADHFE1 partial ORF ( NP_653251, 329 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Name : FBXO36 (Human) Recombinant Protein (P01)Biological Activity : Human FBXO36 full-length ORF ( AAH33935.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : RAVER1 (Human) Recombinant Protein (P01)Biological Activity : Human RAVER1 full-length ORF (NP_597709.1, 1 a.a. - 606 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
Product Name : WSB1 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.37 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Name : OR5P2 (Human) Recombinant Protein (P01)Biological Activity : Human OR5P2 full-length ORF ( NP_703145.1, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : Recombinant Human EIF4EBP2 ProteinTargetID : Q13542Source : E.coliGene Accession Number : 1979Peptide Sequence : 1-120aaTag : N-6HisPurity : >90% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage Buffer…
Product Name : WFS1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 467 µg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Name : WDFY2 (Human) Recombinant Protein (P01)Biological Activity : Human WDFY2 full-length ORF ( NP_443182.1, 1 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : Recombinant Peroxisome Proliferator Activated Receptor Gamma (PPARg)TargetID : P37231Source : E.coliGene Accession Number : 5468Peptide Sequence : Gly349~Glu488Tag : N-6HisPurity : > 90%Formulation : Freeze-dried powderStorage Buffer…
Name : C10orf65 (Human) Recombinant Protein (P01)Biological Activity : Human C10orf65 full-length ORF (BAF82129.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
Product Name : Recombinant Mouse Cxcl12 ProteinTargetID : P40224Source : E.coliGene Accession Number : 20315Peptide Sequence : 22-89aaTag : N-6HisPurity : >90% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage Buffer…
Product Name : VSX2 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.34 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3,…
Name : GLYATL1 (Human) Recombinant Protein (P01)Biological Activity : Human GLYATL1 full-length ORF ( NP_542392.2, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : Recombinant Microtubule Associated Protein 2 (MAP2)TargetID : P20357Source : E.coliGene Accession Number : 17756Peptide Sequence : Thr1457~Ser1728Tag : N-6HisPurity : > 90%Formulation : Freeze-dried powderStorage Buffer :…
Product Name : VSV-G Epitope Tag Polyclonal Antibody, DyLight™ 488Species Reactivity: TagHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : DyLight™ 488Form: LyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer:…
Name : DAPK3 (Human) Recombinant Protein (P01)Biological Activity : Human DAPK3 full-length ORF ( NP_001339.1, 1 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : Recombinant Human Gamma-Aminobutyric Acid B Receptor 1 (gABBR1) ProteinTargetID : Q9UBS5Source : E.coliGene Accession Number : 2550Peptide Sequence : Val199~Gly570Tag : N-6HisPurity : > 90%Formulation : PBSStorage…
Product Name : VSIG1 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Name : TMEM60 (Human) Recombinant ProteinBiological Activity : Human TMEM60 full-length ORF (ADR82699.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane ProteinsTag : Best…
Product Name : Recombinant Human TRAIL R4 / CD264 / TNFRSF10D Protein (His & Fc tag)TargetID : Q9UBN6Source : HEK293 CellsGene Accession Number : 8793Peptide Sequence : Met 1-His 211Tag…
Name : RAB2B (Human) Recombinant Protein (Q01)Biological Activity : Human RAB2B partial ORF ( NP_116235, 127 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Product Name : Recombinant Human DR6 / TNFRSF21 Protein (His tag)TargetID : O75509Source : HEK293 CellsGene Accession Number : 27242Peptide Sequence : Met 1-Leu 350Tag : C-HisPurity : >95% as…
Product Name : VGlut2 Transporter Monoclonal Antibody (S29-29)Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: S29-29Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS,…
Name : TSSK1B (Human) Recombinant Protein (Q01)Biological Activity : Human TSSK1B partial ORF ( AAH22515, 267 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Product Name : Recombinant Rat E-Cadherin / CDH1 / E-cad / CD324 Protein (His tag)TargetID : Q9R0T4Source : HEK293 CellsGene Accession Number : 83502Peptide Sequence : Met1-Ala713Tag : C-HisPurity :…
Product Name : VEGF Monoclonal Antibody (OTI4G3), TrueMAB™Species Reactivity: Dog, HumanHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: OTI4G3Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Name : PUS7L (Human) Recombinant Protein (P01)Biological Activity : Human PUS7L full-length ORF ( NP_112582.2, 1 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : Recombinant Mouse PD-L1 / B7-H1 / CD274 Protein (His & Fc tag)TargetID : Q9EP73Source : HEK293 CellsGene Accession Number : 60533Peptide Sequence : Met 1-Thr 238Tag :…
Product Name : rabbit anti-beta Tubulin monoclonal antibody 9003Host : rabbitIsotype : IgGClonality: monoclonalConcentration: 1 mg/mLApplications: ELISA, ICC/IF, WBRractivity : Available sizes: 100 µgAdditiona Information: 9 5 2 inhostrabbit|isotypeIgG|clonalitymonoclonal|concentration1 mg/mL|applicationsELISA,…
Product Name : Recombinant Human CD44 Protein (His tag)TargetID : P16070Source : HEK293 CellsGene Accession Number : 960Peptide Sequence : Met 1-Pro 220Tag : C-HisPurity : >85% as determined by…
Product Name : Ubiquitin Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 550 µg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : Recombinant Human CLEC3B / Tetranectin Protein (His tag)TargetID : P05452Source : HEK293 CellsGene Accession Number : 7123Peptide Sequence : Met 1-Val 202Tag : C-HisPurity : >95% as…
Product Name : USP9X Recombinant Rabbit Monoclonal Antibody (JG35-11)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JG35-11Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: TBS,…
Product Name : ULBP1 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : Recombinant Human ARG1 / Arginase 1 Protein (His tag)TargetID : P05089Source : HEK293 CellsGene Accession Number : 383Peptide Sequence : Met 1-Lys 322Tag : C-HisPurity : >90%…
Product Name : UNC84A Recombinant Rabbit Monoclonal Antibody (HL1946)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: HL1946Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBSContains…
Product Name : Recombinant Human Arginase Protein (His & MYC Tag)TargetID : P05089Source : HEK293 CellsGene Accession Number : 383Peptide Sequence : Met 1-Lys 322Tag : N-His&C-MYCPurity : >85% as…
Product Name : UBQLN4/CIP75/Ubiquilin 4 Recombinant Rabbit Monoclonal Antibody (BLR145J)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: BLR145JConjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : purifiedStorage buffer: BBS,…
Product Name : UBP1 Monoclonal Antibody (1B10H3)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 1B10H3Conjugate : UnconjugatedForm: LiquidConcentration : 1000 µg/mLPurification : Protein GStorage buffer: PBS, pH 7.3, with…
Product Name : Recombinant Human ADAT2 ProteinTargetID : Q7Z6V5Source : E.coliGene Accession Number : 134637Peptide Sequence : 1-191aaTag : N-6HisPurity : >90% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage Buffer…
Product Name : Trypsin Pan Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Sheep / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LyophilizedConcentration : 0.2 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS with 5%…
Product Name : Recombinant Rat CHODL / Chondrolectin Protein (Fc tag)TargetID : D3ZI86Source : HEK293 CellsGene Accession Number : 288289Peptide Sequence : Met1-Asn216Tag : C-FcPurity : >90% as determined by…
Product Name : UBE2G1 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : Tryptase Recombinant Rabbit Monoclonal Antibody (ARC2328)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ARC2328Conjugate : UnconjugatedForm: LiquidConcentration : 0.4 mg/mLPurification : Affinity chromatographyStorage…
Product Name : Recombinant Human CD28 Protein (Fc tag)TargetID : P10747Source : HEK293 CellsGene Accession Number : 940Peptide Sequence : Met 1-Pro 152Tag : C-FcPurity : >95% as determined by…
Product Name : Recombinant Human IL17 / IL17A Protein (His tag)TargetID : Q16552Source : YeastGene Accession Number : 3605Peptide Sequence : Gly24-Ala155Tag : N-HisPurity : >90% as determined by SDS-PAGE.Formulation…
Product Name : Thyroid Stimulating Hormone Monoclonal Antibody (TSH-51)Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: TSH-51Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS, pH…
Product Name : Recombinant Human Kallikrein 13 ProteinTargetID : Q9UKR3Source : HEK293 CellsGene Accession Number : 26085Peptide Sequence : Gly17-Ile262Tag : C-6HisPurity : >95% as determined by SDS-PAGE.Formulation : Freeze-dried…
Product Name : Tom22 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.27 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : Recombinant Human Zinc Finger Protein 70/ZNF70 Protein(N-6His)TargetID : Q9UC06Source : E.coliGene Accession Number : 7621Peptide Sequence : Met 1-Leu446Tag : N-6HisPurity : >90% as determined by SDS-PAGE.Formulation…
Product Name : Thymidine Phosphorylase/PD-ECGF (Angiogenesis Marker) Monoclonal Antibody (P-GF.44C)Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: P-GF.44CConjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein…
Product Name : Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA Protein(N-6His)TargetID : P20033Source : E.coliGene Accession Number : 18590Peptide Sequence : Ser87-Thr 211Tag : N-6HisPurity : >85% as determined by SDS-PAGE.Formulation…
Product Name : Theromacin Polyclonal AntibodySpecies Reactivity: LeechHost/Isotype : Rabbit / IgClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LyophilizedConcentration : Conc. Not DeterminedPurification : Storage buffer: whole serumContains : no preservativeStorage…
Product Name : Recombinant Human GM-CSF/CSF2 ProteinTargetID : P04141Source : P.pastorisGene Accession Number : 1437Peptide Sequence : Ala18-Glu144Tag : Purity : >85% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage Buffer…
Product Name : TTF1 Monoclonal Antibody (2F4B12)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 2F4B12Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein GStorage buffer: PBSContains : 0.05% sodium…
Product Name : Recombinant Mouse EphB4 / HTK Protein (His tag)TargetID : P54761Source : HEK293 CellsGene Accession Number : 13846Peptide Sequence : Met 1-Ala 539Tag : C-HisPurity : >90% as…
Product Name : TSH Receptor Monoclonal Antibody (49)Species Reactivity: Human, PigHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 49Conjugate : UnconjugatedForm: LiquidConcentration : Conc. Not DeterminedPurification : Storage buffer: ascitesContains :…
Product Name : TRPM2 Polyclonal Antibody, BiotinSpecies Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.82 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBSContains :…
Name : ITPKC (Human) Recombinant Protein (P01)Biological Activity : Human ITPKC full-length ORF ( NP_079470.1, 1 a.a. - 683 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : TRMT2A Monoclonal Antibody (OTI3B7), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI3B7Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Name : CTNNA1 (Human) Recombinant Protein (Q01)Biological Activity : Human CTNNA1 partial ORF ( NP_001894, 152 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Product Name : TRIM68 Monoclonal Antibody (5G2)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 5G2Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Name : LASS4 (Human) Recombinant Protein (P01)Biological Activity : Human LASS4 full-length ORF ( NP_078828.1, 1 a.a. - 394 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : TRIM30 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBSContains : 0.02%…
Product Name : TP53TG3 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50% glycerol, 1%…
Name : WNK4 (Human) Recombinant Protein (Q01)Biological Activity : Human WNK4 partial ORF ( NP_115763.2, 1144 a.a. - 1243 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Product Name : TRAF4 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: liquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: phosphate/tris citrate, pH…
Name : CSF2 (Human) Recombinant Protein (P01)Biological Activity : Human CSF2 full-length ORF ( AAI14000.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Name : ICEBERG (Human) Recombinant Protein (P01)Biological Activity : Human ICEBERG full-length ORF ( NP_067546.1, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : TNS1 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.39 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3,…
Name : KIAA1618 (Human) Recombinant Protein (P01)Biological Activity : Human KIAA1618 full-length ORF ( AAH36891.1, 1 a.a. - 1063 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : TNK1 Monoclonal Antibody (E.359.10)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:MonoclonalType : AntibodyClone: E.359.10Conjugate : UnconjugatedForm: LiquidConcentration : 27.4 mg/mLPurification : Affinity chromatographyStorage buffer: 0.01M HEPES, pH 7.5,…
Name : ZNF304 (Human) Recombinant Protein (P01)Biological Activity : Human ZNF304 full-length ORF ( ABZ92361.1, 1 a.a. - 706 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
And displacement is a fundamental reaction for both in vivo and in vitro biological events such as genomic DNA replication, transcription, and PCR. It is usually a very fast reaction…
Name : CD248 (Human) Recombinant Protein (P03)Biological Activity : Human CD248 full-length ORF ( NP_065137.1, 18 a.a. - 757 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : TNF alpha Monoclonal Antibody (MAb1)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: MAb1Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS, pH…
Name : TMEPAI (Human) Recombinant Protein (Q01)Biological Activity : Human TMEPAI partial ORF ( AAH15918, 181 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Product Name : TMEM80 Monoclonal Antibody (OTI3A6), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI3A6Conjugate : UnconjugatedForm: liquidConcentration : 0.54 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
Product Name : TMEM38B Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.38 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : TMC2 Polyclonal Antibody, FITCSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary buffer,…
Product Name : TLR9 Monoclonal Antibody (3B7)Species Reactivity: Mouse, HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 3B7Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains…
Product Name : TIPIN Monoclonal Antibody (OTI1A3), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: OTI1A3Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : THUMPD1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.15 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : TGIF2 Monoclonal Antibody (3G8)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: 3G8Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : TGF beta-1 Recombinant Rabbit Monoclonal Antibody (PD00-17)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: PD00-17Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein…
Name : PCDHB6 (Human) Recombinant Protein (P01)Biological Activity : Human PCDHB6 full-length ORF ( AAI52976.1, 1 a.a. - 794 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : itchy E3 ubiquitin protein ligaseTarget gene : ITCHverified_species_reactivity : Humaninterspecies_information : 79%, ENSMUSG00000027598, species_id: MOUSE, 79%, ENSRNOG00000059043, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : TFAP2A/AP-2 Polyclonal Antibody, CoraLite® Plus 488Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : CoraLite® Plus 488Form: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer:…
Product Name : interleukin 37Target gene : IL37verified_species_reactivity : Humaninterspecies_information : 32%, ENSMUSG00000026983, species_id: MOUSE, 31%, ENSRNOG00000005701, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : TDG / Thymine-DNA glycosylase Polyclonal AntibodySpecies Reactivity: MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.5,…
Name : UCHL5IP (Human) Recombinant Protein (P01)Biological Activity : Human UCHL5IP full-length ORF ( NP_059988.3, 1 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : IKAROS family zinc finger 4 (Eos)Target gene : IKZF4verified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000002578, species_id: MOUSE, 84%, ENSRNOG00000005535, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : TCR V beta 5b Monoclonal Antibody (W112), FITCSpecies Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: W112Conjugate : FITC View additional formats UnconjugatedForm: LiquidConcentration : 0.15 mg/mLPurification…
Name : RNF121 (Human) Recombinant Protein (Q01)Biological Activity : Human RNF121 partial ORF ( NP_060790.2, 193 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Product Name : inhibitor of DNA binding 1, dominant negative helix-loop-helix proteinTarget gene : ID1verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000042745, species_id: MOUSE, 95%, ENSRNOG00000021750, species_id: RATclonality : Polyclonalisotype : IgGhost…
Name : C20orf27 (Human) Recombinant Protein (P01)Biological Activity : Human C20orf27 full-length ORF ( AAH12196, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : homeobox B7Target gene : HOXB7verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000038721, species_id: MOUSE, 98%, ENSRNOG00000007611, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : TACR2 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.35 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Name : CCBP2 (Human) Recombinant Protein (P02)Biological Activity : Human CCBP2 full-length ORF ( NP_001287.2, 1 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : histidine triad nucleotide binding protein 2Target gene : HINT2verified_species_reactivity : Humaninterspecies_information : 88%, ENSMUSG00000028470, species_id: MOUSE, 89%, ENSRNOG00000015866, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : Syntaxin 1a (STX1A) Monoclonal Antibody (OTI2F11)Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI2F11Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer:…
Name : RIN2 (Human) Recombinant Protein (Q01)Biological Activity : Human RIN2 partial ORF ( NP_061866, 786 a.a. - 894 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Product Name : hyperpolarization activated cyclic nucleotide-gated potassium channel 3Target gene : HCN3verified_species_reactivity : Humaninterspecies_information : 88%, ENSMUSG00000028051, species_id: MOUSE, 88%, ENSRNOG00000020444, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : Sumo 1 (SUMO1) Monoclonal Antibody (OTI1E8), TrueMAB™Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1E8Conjugate : UnconjugatedForm: LyophilizedConcentration : See LabelPurification : Protein A/GStorage…
Product Name : glutathione S-transferase kappa 1Target gene : GSTK1verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000029864, species_id: MOUSE, 62%, ENSRNOG00000016484, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Smooth Muscle Myosin Monoclonal Antibody (SMMS-1), Alexa Fluor™ 488, eBioscience™Species Reactivity: Bovine, Dog, Cat, Human, RatHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: SMMS-1Conjugate : Alexa Fluor™…
Product Name : glutamate receptor, ionotropic, delta 2 (Grid2) interacting proteinTarget gene : GRID2IPverified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000010825, species_id: MOUSE, 97%, ENSRNOG00000030927, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : Smoothened homolog Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : glypican 5Target gene : GPC5verified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000022112, species_id: MOUSE, 45%, ENSRNOG00000060179, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : Saccharomyces cerevisiae Alcohol dehydrogenase Polyclonal Antibody, BiotinSpecies Reactivity: YeastHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LyophilizedConcentration : 10 mg/mLPurification : Protein GStorage buffer: PBSContains…
Product Name : G elongation factor, mitochondrial 1Target gene : GFM1verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000027774, species_id: MOUSE, 96%, ENSRNOG00000012873, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : SYTL1 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 2% sucroseContains :…
Product Name : galanin receptor 1Target gene : GALR1verified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000024553, species_id: MOUSE, 81%, ENSRNOG00000016654, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : STYK1 Monoclonal Antibody (3A8)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 3A8Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : formimidoyltransferase cyclodeaminaseTarget gene : FTCDverified_species_reactivity : Humaninterspecies_information : 75%, ENSMUSG00000001155, species_id: MOUSE, 75%, ENSRNOG00000001261, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : STRADA Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : forkhead box O4Target gene : FOXO4verified_species_reactivity : Humaninterspecies_information : 87%, ENSMUSG00000042903, species_id: MOUSE, 85%, ENSRNOG00000033316, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : STING1/TMEM173 Monoclonal Antibody (STING1/7441)Species Reactivity: HumanHost/Isotype : Mouse / IgG2c, kappaClass:MonoclonalType : AntibodyClone: STING1/7441Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein A/GStorage buffer: PBS, pH 7.4,…
Product Name : free fatty acid receptor 4Target gene : FFAR4verified_species_reactivity : Humaninterspecies_information : 82%, ENSMUSG00000054200, species_id: MOUSE, 82%, ENSRNOG00000021763, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : STAT3 Polyclonal Antibody, BiotinSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary buffer,…
Product Name : family with sequence similarity 58, member ATarget gene : FAM58Averified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000049489, species_id: MOUSE, 91%, ENSRNOG00000022582, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : ST6GALNAC2 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : family with sequence similarity 184, member ATarget gene : FAM184Averified_species_reactivity : Humaninterspecies_information : 87%, ENSMUSG00000019856, species_id: MOUSE, 89%, ENSRNOG00000026407, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : SSEA1 Monoclonal Antibody (eBioMC-480 (MC-480)), Biotin, eBioscience™Species Reactivity: Human, MouseHost/Isotype : Mouse / IgMClass:MonoclonalType : AntibodyClone: eBioMC-480 (MC-480)Conjugate : Biotin View additional formats Alexa Fluor 488 eFluor…
Product Name : family with sequence similarity 126, member ATarget gene : FAM126Averified_species_reactivity : Humaninterspecies_information : 82%, ENSMUSG00000028995, species_id: MOUSE, 77%, ENSRNOG00000010517, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : SRCRB4D Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein A, Antigen affinity chromatographyStorage buffer: PBS, pH 7.4Contains…
Product Name : exocyst complex component 6BTarget gene : EXOC6Bverified_species_reactivity : Humaninterspecies_information : 80%, ENSMUSG00000033769, species_id: MOUSE, 78%, ENSRNOG00000059615, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SPP1 Monoclonal Antibody (2D12)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: 2D12Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : ELKS/RAB6-interacting/CAST family member 2Target gene : ERC2verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000040640, species_id: MOUSE, 100%, ENSRNOG00000015148, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SPI-B Monoclonal Antibody (235D), eBioscience™Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 235DConjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : eukaryotic translation initiation factor 4E family member 2Target gene : EIF4E2verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000026254, species_id: MOUSE, 95%, ENSRNOG00000019634, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : SPACA3 Polyclonal Antibody, FITCSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary buffer,…
Product Name : Tu translation elongation factor, mitochondrialTarget gene : TUFMverified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000030735, species_id: MOUSE, 96%, ENSRNOG00000018604, species_id: RATclonality : Monoclonalisotype : IgG1host : Mousebuffer : 40%…
Product Name : SOX11 Monoclonal Antibody (SOX11-C1), eBioscience™Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: SOX11-C1Conjugate : Unconjugated View additional formats Biotin eFluor 660Form: LiquidConcentration : 0.5 mg/mLPurification…
Product Name : DTW domain containing 1Target gene : DTWD1verified_species_reactivity : Humaninterspecies_information : 87%, ENSMUSG00000023330, species_id: MOUSE, 90%, ENSRNOG00000009593, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SNX17 Monoclonal Antibody (3B8F6), CoraLite® Plus 488Species Reactivity: Human, Pig, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 3B8F6Conjugate : CoraLite® Plus 488 View additional formats UnconjugatedForm: LiquidConcentration…
Product Name : Troponin t2, cardiac typeTarget gene : TNNT2verified_species_reactivity : Humaninterspecies_information : 77%, ENSRNOG00000033734, species_id: RAT, 73%, ENSMUSG00000026414, species_id: MOUSEclonality : Monoclonalisotype : IgG1host : Mousebuffer : The antibodies…
Product Name : SNRNP48 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : DnaJ (Hsp40) homolog, subfamily A, member 2Target gene : DNAJA2verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000031701, species_id: MOUSE, 99%, ENSRNOG00000016251, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : SMIM5 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.05 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
Name : VPS54 (Human) Recombinant Protein (P01)Biological Activity : Human VPS54 full-length ORF ( AAH41868.1, 1 a.a. - 824 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Product Name : DENN domain containing 4BTarget gene : DENND4Bverified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000042404, species_id: MOUSE, 93%, ENSRNOG00000022373, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SMAD7 Monoclonal Antibody (4G11)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 4G11Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : DEAD (Asp-Glu-Ala-Asp) box polypeptide 52Target gene : DDX52verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000020677, species_id: MOUSE, 60%, ENSRNOG00000002612, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : BAF chromatin remodeling complex subunit BCL11ATarget gene : BCL11Averified_species_reactivity : Humaninterspecies_information : 92%, ENSRNOG00000007049, species_id: RAT, 92%, ENSMUSG00000000861, species_id: MOUSEclonality : Monoclonalisotype : IgG1host : Mousebuffer :…
Product Name : SLC6A19 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: PBS with 50% glycerolContains…
Product Name : cysteine and glycine-rich protein 3 (cardiac LIM protein)Target gene : CSRP3verified_species_reactivity : Humaninterspecies_information : 94%, ENSMUSG00000030470, species_id: MOUSE, 94%, ENSRNOG00000014327, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : SLC39A6 Recombinant Human Monoclonal Antibody (13F1)Species Reactivity: HumanHost/Isotype : Human / IgG1Class:Recombinant MonoclonalType : AntibodyClone: 13F1Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS,…
Product Name : COX20 cytochrome C oxidase assembly factorTarget gene : COX20verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000111742, species_id: MOUSE, 65%, ENSRNOG00000004553, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : SILV Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
Product Name : collagen, type VIII, alpha 2Target gene : COL8A2verified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000056174, species_id: MOUSE, 95%, ENSRNOG00000010841, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : SHH Monoclonal Antibody (OTI3A2), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI3A2Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : clavesin 1Target gene : CLVS1verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000041216, species_id: MOUSE, 100%, ENSRNOG00000006919, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : SFTPD Monoclonal Antibody (C4)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: C4Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein A/GStorage buffer: PBS with 50%…
Product Name : carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5Target gene : CHST5verified_species_reactivity : Humaninterspecies_information : 41%, ENSMUSG00000099032, species_id: MOUSE, 37%, ENSRNOG00000057384, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : SF3B4 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.33 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : cingulinTarget gene : CGNverified_species_reactivity : Humaninterspecies_information : 87%, ENSMUSG00000068876, species_id: MOUSE, 83%, ENSRNOG00000020952, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS (pH…
Product Name : SERPINB4 Monoclonal Antibody (OTI4C8), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4C8Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : cilia and flagella associated protein 46Target gene : CFAP46verified_species_reactivity : Humaninterspecies_information : 82%, ENSMUSG00000049571, species_id: MOUSE, 84%, ENSRNOG00000027374, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : SERBP1 Monoclonal Antibody (OTI2C11), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI2C11Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : cadherin-related family member 2Target gene : CDHR2verified_species_reactivity : Humaninterspecies_information : 72%, ENSMUSG00000034918, species_id: MOUSE, 74%, ENSRNOG00000017917, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SECTM1 Monoclonal Antibody (01)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 01Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBSContains : no preservativeStorage…
Product Name : MesothelinTarget gene : MSLNverified_species_reactivity : Humaninterspecies_information : 62%, ENSRNOG00000019445 , species_id: RAT, 63%, ENSMUSG00000063011, species_id: MOUSEclonality : Monoclonalisotype : IgG2bhost : Mousebuffer : The antibodies are delivered…
Product Name : SCP2 Monoclonal Antibody (OTI3H1), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI3H1Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : coiled-coil domain containing 39Target gene : CCDC39verified_species_reactivity : Humaninterspecies_information : 79%, ENSMUSG00000027676, species_id: MOUSE, 81%, ENSRNOG00000011440, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : coiled-coil domain containing 138Target gene : CCDC138verified_species_reactivity : Humaninterspecies_information : 58%, ENSMUSG00000038010, species_id: MOUSE, 62%, ENSRNOG00000028581, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : SCAND3 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
Product Name : SARS-CoV-2 Spike Recombinant Human Monoclonal Antibody (AM009105)Species Reactivity: VirusHost/Isotype : Human / IgG1Class:Recombinant MonoclonalType : AntibodyClone: AM009105Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: 32mM…
Product Name : chromosome 4 open reading frame 36Target gene : C4orf36verified_species_reactivity : Humaninterspecies_information : 53%, ENSMUSG00000029320, species_id: MOUSE, 51%, ENSRNOG00000060245, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : SARS-CoV-2 Nucleocapsid Monoclonal Antibody (7E2)Species Reactivity: VirusHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 7E2Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBSContains :…
Product Name : integrin subunit alpha 8Target gene : ITGA8verified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000026768, species_id: MOUSE, 91%, ENSRNOG00000016538, species_id: RATclonality : Monoclonalisotype : IgG1host : Mousebuffer : The antibodies…
Product Name : SAPAP4/DLGAP4 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50%…
Product Name : chromosome 14 open reading frame 79Target gene : C14orf79verified_species_reactivity : Humaninterspecies_information : 63%, ENSMUSG00000037594, species_id: MOUSE, 66%, ENSRNOG00000013690, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : S100A8/A9 Monoclonal Antibody (OTI6A12), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: OTI6A12Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein A/GStorage buffer: PBS with 1%…
Product Name : bromodomain and PHD finger containing, 3Target gene : BRPF3verified_species_reactivity : Humaninterspecies_information : 83%, ENSMUSG00000063952, species_id: MOUSE, 82%, ENSRNOG00000028641, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : S Tag Polyclonal Antibody, AgaroseSpecies Reactivity: TagHost/Isotype : Goat / IgGClass:PolyclonalType : AntibodyClone: Conjugate : AgaroseForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: PBS, pH 6.8…
Product Name : 3-hydroxybutyrate dehydrogenase, type 1Target gene : BDH1verified_species_reactivity : Humaninterspecies_information : 88%, ENSMUSG00000046598, species_id: MOUSE, 86%, ENSRNOG00000001736, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Rhodopsin Monoclonal Antibody (4D2), FITCSpecies Reactivity: Amphibian, Avian, Bovine, Fish, Human, Mouse, SharkHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 4D2Conjugate : FITC View additional formats APC PerCPForm:…
Product Name : aurora kinase BTarget gene : AURKBverified_species_reactivity : Humaninterspecies_information : 55%, ENSMUSG00000020897, species_id: MOUSE, 53%, ENSRNOG00000005659, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : Radixin Recombinant Rabbit Monoclonal Antibody (ARC2277)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ARC2277Conjugate : UnconjugatedForm: LiquidConcentration : 0.22 mg/mLPurification : Affinity chromatographyStorage…
Product Name : zinc finger and SCAN domain containing 25Target gene : ZSCAN25verified_species_reactivity : Humaninterspecies_information : 72%, ENSMUSG00000070420, species_id: MOUSE, 73%, ENSRNOG00000042213, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : RSV NP Recombinant Rabbit Monoclonal Antibody (HL1296)Species Reactivity: VirusHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: HL1296Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer:…
Product Name : zinc finger protein 598Target gene : ZNF598verified_species_reactivity : Humaninterspecies_information : 86%, ENSMUSG00000041130, species_id: MOUSE, 86%, ENSRNOG00000012434, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : RSBN1L Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50% glycerol, 1%…
Product Name : zinc finger protein 561Target gene : ZNF561verified_species_reactivity : Humaninterspecies_information : 50%, ENSMUSG00000059475, species_id: MOUSE, 46%, ENSRNOG00000020356, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : zinc finger protein 207Target gene : ZNF207verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000017421, species_id: MOUSE, 100%, ENSRNOG00000000236, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : zinc finger, DHHC-type containing 20Target gene : ZDHHC20verified_species_reactivity : Humaninterspecies_information : 94%, ENSMUSG00000021969, species_id: MOUSE, 93%, ENSRNOG00000011024, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : RORB Monoclonal Antibody (OTI1G1)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1G1Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : ATPase, class V, type 10DTarget gene : ATP10Dverified_species_reactivity : Humaninterspecies_information : 26%, ENSMUSG00000036980, species_id: MOUSE, 63%, ENSRNOG00000002312, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : RNF26 Monoclonal Antibody (5B9)Species Reactivity: HumanHost/Isotype : Mouse / IgG3, kappaClass:MonoclonalType : AntibodyClone: 5B9Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : YdjC homolog (bacterial)Target gene : YDJCverified_species_reactivity : Humaninterspecies_information : 79%, ENSMUSG00000041774, species_id: MOUSE, 79%, ENSRNOG00000001861, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : RND1 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4Contains :…
Product Name : V-set and transmembrane domain containing 2ATarget gene : VSTM2Averified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000048834, species_id: MOUSE, 71%, ENSRNOG00000005180, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : RIT2 Monoclonal Antibody (OTI4B5), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: OTI4B5Conjugate : UnconjugatedForm: liquidConcentration : 0.84 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
Product Name : asteroid homolog 1 (Drosophila)Target gene : ASTE1verified_species_reactivity : Humaninterspecies_information : 82%, ENSMUSG00000032567, species_id: MOUSE, 89%, ENSRNOG00000013059, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : ubiquitin specific peptidase 26Target gene : USP26verified_species_reactivity : Humaninterspecies_information : 30%, ENSMUSG00000033364, species_id: MOUSE, 30%, ENSRNOG00000022720, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Anti-Human MAPT/Tau/PHF-tau BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
Product Name : thioredoxin reductase 2Target gene : TXNRD2verified_species_reactivity : Humaninterspecies_information : 80%, ENSMUSG00000099282, species_id: MOUSE, 80%, ENSRNOG00000001890, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : Anti-SARS-CoV-2 S protein BiosimilarHost species : HumanSpecies reactivity : SARS-CoV-2 (2019-nCoV)Form: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research…
Product Name : ankyrin repeat and SOCS box containing 18Target gene : ASB18verified_species_reactivity : Humaninterspecies_information : 72%, ENSMUSG00000067081, species_id: MOUSE, 71%, ENSRNOG00000019557, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : H3K4me2T6ph Polyclonal AntibodySpecies Reactivity: C. elegans, Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.31 mg/mLPurification : Affinity chromatographyStorage buffer: 0.02M…
Product Name : TSPY-like 6Target gene : TSPYL6verified_species_reactivity : Humaninterspecies_information : 25%, ENSMUSG00000022148, species_id: MOUSE, 25%, ENSRNOG00000007172, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : H-2Kb/H-2Db Monoclonal Antibody (5041.16.1), BiotinSpecies Reactivity: MouseHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: 5041.16.1Conjugate : Biotin View additional formats FITC PEForm: LiquidConcentration : 0.1 mg/mLPurification : Protein…
Product Name : tripartite motif containing 34Target gene : TRIM34verified_species_reactivity : Humaninterspecies_information : 62%, ENSMUSG00000090215, species_id: MOUSE, 62%, ENSRNOG00000042686, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : transducer of ERBB2, 1Target gene : TOB1verified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000037573, species_id: MOUSE, 91%, ENSRNOG00000002828, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : GluR3 Polyclonal AntibodySpecies Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS,…
Product Name : transmembrane protein 40Target gene : TMEM40verified_species_reactivity : Humaninterspecies_information : 83%, ENSMUSG00000059900, species_id: MOUSE, 83%, ENSRNOG00000010430, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : Galectin 3 Recombinant Rabbit Monoclonal Antibody (4M10)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 4M10Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer:…
Product Name : translation machinery associated 16 homolog (S. cerevisiae)Target gene : TMA16verified_species_reactivity : Humaninterspecies_information : 62%, ENSMUSG00000025591, species_id: MOUSE, 62%, ENSRNOG00000014188, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : GTPBP4 Recombinant Rabbit Monoclonal Antibody (JE47-47)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JE47-47Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: TBS,…
Product Name : ADP-ribosylation factor-like 6 interacting protein 6Target gene : ARL6IP6verified_species_reactivity : Humaninterspecies_information : 72%, ENSMUSG00000026960, species_id: MOUSE, 67%, ENSRNOG00000005074, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : GSTA1/A2/A3/A4/A5 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LyophilizedConcentration : 500 µg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS with…
Product Name : Treacher Collins-Franceschetti syndrome 1Target gene : TCOF1verified_species_reactivity : Humaninterspecies_information : 37%, ENSMUSG00000024613, species_id: MOUSE, 32%, ENSRNOG00000026108, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : GRP94/HSP90B1 (Endoplasmic Reticulum Marker) Monoclonal Antibody (HSP90B1/1192)Species Reactivity: HumanHost/Isotype : Rat / IgG2a, kappaClass:MonoclonalType : AntibodyClone: HSP90B1/1192Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein A/GStorage buffer:…
Product Name : T-box 6Target gene : TBX6verified_species_reactivity : Humaninterspecies_information : 94%, ENSMUSG00000030699, species_id: MOUSE, 94%, ENSRNOG00000019771, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : GRB10 Recombinant Rabbit Monoclonal Antibody (1D13)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 1D13Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer:…
Product Name : surfeit 6Target gene : SURF6verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000036160, species_id: MOUSE, 89%, ENSRNOG00000005031, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : GPX1 Recombinant Rabbit Monoclonal Antibody (JJ092-07)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JJ092-07Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
Product Name : staufen double-stranded RNA binding protein 2Target gene : STAU2verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000025920, species_id: MOUSE, 56%, ENSRNOG00000042458, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : GPR31 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50% glycerol, 1%…
Product Name : ST6 beta-galactosamide alpha-2,6-sialyltranferase 2Target gene : ST6GAL2verified_species_reactivity : Humaninterspecies_information : 59%, ENSMUSG00000098633, species_id: MOUSE, 60%, ENSRNOG00000046515, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : GP130 Monoclonal Antibody (8D4D2)Species Reactivity: Human, Non-human primateHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 8D4D2Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein GStorage buffer: PBSContains :…
Product Name : GNL3L Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 1%…
Product Name : small nuclear ribonucleoprotein polypeptides B and B1Target gene : SNRPBverified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000027404, species_id: MOUSE, 100%, ENSRNOG00000059764, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : Anti-Human CD220/INSR BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
Product Name : small integral membrane protein 7Target gene : SMIM7verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000044600, species_id: MOUSE, 100%, ENSRNOG00000042037, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : Anti-Human CD115/CSF1R BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
Product Name : solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1Target gene : SLC9B1verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000050150, species_id: MOUSE, 65%, ENSRNOG00000042985, species_id: RATclonality…
Product Name : Bifikafusp Alfa BiosimilarHost species : Species reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: Applications : Research Grade BiosimilarTarget…
Product Name : solute carrier family 1 (glutamate/neutral amino acid transporter), member 4Target gene : SLC1A4verified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000020142, species_id: MOUSE, 87%, ENSRNOG00000005248, species_id: RATclonality : Polyclonalisotype :…
Product Name : Anti-Human CD197/CCR7 BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1.11 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
Product Name : sirtuin 7Target gene : SIRT7verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000025138, species_id: MOUSE, 95%, ENSRNOG00000036683, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : SH2 domain containing 1BTarget gene : SH2D1Bverified_species_reactivity : Humaninterspecies_information : 79%, ENSMUSG00000073494, species_id: MOUSE, 75%, ENSRNOG00000038432, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : splicing factor 3a, subunit 2, 66kDaTarget gene : SF3A2verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000020211, species_id: MOUSE, 100%, ENSRNOG00000019349, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : succinate dehydrogenase complex assembly factor 2Target gene : SDHAF2verified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000024668, species_id: MOUSE, 92%, ENSRNOG00000020646, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : CCT244747Description:CCT244747 is a potent, orally bioavailable and highly selective CHK1 inhibitor, with an IC50 of 7.7 nM; CCT244747 also abrogates G2 checkpoint with an IC50 of 29…
Product Name : seryl-tRNA synthetaseTarget gene : SARSverified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000068739, species_id: MOUSE, 93%, ENSRNOG00000020255, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : regulation of nuclear pre-mRNA domain containing 2Target gene : RPRD2verified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000028106, species_id: MOUSE, 94%, ENSRNOG00000054294, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : TfRTarget points: PeptiDreamStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : RPGRIP1-likeTarget gene : RPGRIP1Lverified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000033282, species_id: MOUSE, 94%, ENSRNOG00000011829, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS (pH…
Product Name : IL-1RAPTarget points: LEO PharmaStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : ring finger protein 165Target gene : RNF165verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000025427, species_id: MOUSE, 99%, ENSRNOG00000048824, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : Siglec-15Target points: ElpisStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : DysferlinTarget gene : DYSFverified_species_reactivity : Humaninterspecies_information : 88%, ENSRNOG00000032788, species_id: RAT, 88%, ENSMUSG00000033788, species_id: MOUSEclonality : Monoclonalisotype : IgG1host : Mousebuffer : The antibodies are delivered in…
Product Name : UndisclosedTarget points: Hangzhou DAC BiotechStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : ankyrin repeat and sterile alpha motif domain containing 4BTarget gene : ANKS4Bverified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000030909, species_id: MOUSE, 78%, ENSRNOG00000046181, species_id: RATclonality : Polyclonalisotype : IgGhost…
Product Name : NKGC2Target points: BioLegendStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : RAB, member of RAS oncogene family like 3Target gene : RABL3verified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000022827, species_id: MOUSE, 93%, ENSRNOG00000026085, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Product Name : MDM2Target points: OncolyzeStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : pseudouridylate synthase 7 homolog (S. cerevisiae)-likeTarget gene : PUS7Lverified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000033356, species_id: MOUSE, 81%, ENSRNOG00000022570, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : PEDFVEGFTarget points: Status: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : phosphotriesterase relatedTarget gene : PTERverified_species_reactivity : Humaninterspecies_information : 90%, ENSMUSG00000026730, species_id: MOUSE, 92%, ENSRNOG00000017328, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : UndisclosedTarget points: Shanghai BenemaeStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : ankyrin repeat domain 13ATarget gene : ANKRD13Averified_species_reactivity : Humaninterspecies_information : 82%, ENSMUSG00000041870, species_id: MOUSE, 79%, ENSRNOG00000001204, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : PD-L1Target points: Shandong BoanStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : protein phosphatase 2, regulatory subunit B'', alphaTarget gene : PPP2R3Averified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000043154, species_id: MOUSE, 89%, ENSRNOG00000022999, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : POM121 transmembrane nucleoporin-like 12Target gene : POM121L12verified_species_reactivity : Humaninterspecies_information : 31%, ENSMUSG00000034751, species_id: MOUSE, 31%, ENSRNOG00000027002, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : LAG-3Target points: Single Cell Tech.Status: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Product Name : protein kinase, membrane associated tyrosine/threonine 1Target gene : PKMYT1verified_species_reactivity : Humaninterspecies_information : 74%, ENSMUSG00000023908, species_id: MOUSE, 75%, ENSRNOG00000003657, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : EndosialinLGALS3BPTarget points: MediaPharmaStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : phospholipase D2Target gene : PLD2verified_species_reactivity : Humaninterspecies_information : 86%, ENSMUSG00000020828, species_id: MOUSE, 85%, ENSRNOG00000019604, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : GARPTGF-β1Target points: SimcereStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : phosphatidylinositol glycan anchor biosynthesis, class KTarget gene : PIGKverified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000039047, species_id: MOUSE, 82%, ENSRNOG00000042359, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Product Name : CD47Target points: Shanghai PharmaexplorerStatus: CD47Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : progesterone receptor membrane component 2Target gene : PGRMC2verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000049940, species_id: MOUSE, 98%, ENSRNOG00000014051, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : FGFR1Klotho betaTarget points: SanofiStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : phosphodiesterase 2A, cGMP-stimulatedTarget gene : PDE2Averified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000110195, species_id: MOUSE, 97%, ENSRNOG00000019560, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : UnspecfiedTarget points: AbGenomicsStatus: UnspecfiedOrganization : UnknownShort name : 0Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : parvin, alphaTarget gene : PARVAverified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000030770, species_id: MOUSE, 98%, ENSRNOG00000015713, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : 4-1BBCLDN6Target points: I-Mab BiopharmaStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : orthodenticle homeobox 1Target gene : OTX1verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000005917, species_id: MOUSE, 73%, ENSRNOG00000059469, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : BAFFTarget points: Therasource BiosciencesStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : opticinTarget gene : OPTCverified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000010311, species_id: MOUSE, 86%, ENSRNOG00000003059, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS (pH…
Product Name : HLA-GTarget points: University of Southern CaliforniaStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies…
Product Name : non-SMC element 4 homolog A (S. cerevisiae)Target gene : NSMCE4Averified_species_reactivity : Humaninterspecies_information : 87%, ENSMUSG00000040331, species_id: MOUSE, 87%, ENSRNOG00000020452, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
Product Name : EGFRCD3Target points: Tohoku UniversityStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : notch receptor 3Target gene : NOTCH3verified_species_reactivity : Humaninterspecies_information : 90%, ENSMUSG00000038146, species_id: MOUSE, 94%, ENSRNOG00000004346, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : HER2/neuTarget points: SpirogenStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : NIP7, nucleolar pre-rRNA processing proteinTarget gene : NIP7verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000031917, species_id: MOUSE, 98%, ENSRNOG00000020391, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Product Name : PLD4Target points: SBI BiotechStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : NADH:ubiquinone oxidoreductase subunit C1Target gene : NDUFC1verified_species_reactivity : Humaninterspecies_information : 86%, ENSMUSG00000037152, species_id: MOUSE, 91%, ENSRNOG00000038218, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Product Name : ANGPTL8Target points: RegeneronStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : neuron navigator 1Target gene : NAV1verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000009418, species_id: MOUSE, 97%, ENSRNOG00000008425, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Product Name : BaxTarget points: National Research Council of CanadaStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream.…
Product Name : myosin IXATarget gene : MYO9Averified_species_reactivity : Humaninterspecies_information : 77%, ENSMUSG00000039585, species_id: MOUSE, 76%, ENSRNOG00000011619, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Product Name : CTLA4PD-L1Target points: AlphamabStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Product Name : CD38Target points: University of PennsylvaniaStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Product Name : ADAM17Target points: MedimmuneStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
The REarranged during Transfection (RET) receptor tyrosine kinase (RTK) regulates key aspects of cellular proliferation and survival by regulating the activity of the mitogen- activated protein kinase (MAPK) and PI3K/Akt signaling pathways.…
Product Name : mPEG44-OCH2COOHFull Name: mPEG44-CH2COOHSynonyms : mPEG2000-CH2COOH, mPEG44-CH2COOHCAS:Molecular formula : C91H182O47Molecular Weight: 2028.815610-63-0 Technical Information 42Appearance: Colorless Viscous LiquidStorage: -18℃ for long term storage749886-87-1 web PMID:30480939 MedChemExpress (MCE) offers…
Product Name : DKK1RANKLTarget points: Eli LillyStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Methyltetrazine-CH2NHCO-PEG5-CH2-C≡CHFull Name: Methyltetrazine-CH2NHCO-PEG5-CH2-C≡CHSynonyms : Methyltetrazine-CH2NHCO-PEG5-CH2-C≡CHCAS:Molecular formula : C24H33N5O6Molecular Weight: 487.1421936-85-7 supplier 56Appearance: Storage: -18℃ for long term storage937272-79-2 In Vivo PMID:30860753 MedChemExpress (MCE) offers a wide range…
Product Name : RANKLTarget points: InnoventStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Rho GTPases participate in the regulation of cell migration, invasion, apoptosis, cell-to-cell and cell-to-extracellular matrix adhesions. The Rho GTPases Rac and Cdc42 potently induce actin polymerization. In addition, Cdc42 plays a…
Product Name : ABAT Monoclonal Antibody (UMAB180), UltraMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: UMAB180Conjugate : UnconjugatedForm: liquidConcentration : 0.5-1.0 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
Product Name : C16orf54Target points: IgenicaStatus: C16orf54Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Rabbit anti-RUNX2 Polyclonal AntibodySynonym : AML3; CBF-alpha-1; CBFA1; CCD; CCD1; CLCD; OSF-2; OSF2; PEA2aA; PEBP2aAHost : RabbitSpecies Reactivity: Human, MouseSpecificity : Predicted Reactivity: Applications : WB 1:200…
Product Name : LGR5Target points: GenentechStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Rabbit anti-TXNDC5 Polyclonal Antibody(Center)Synonym : Thioredoxin domain-containing protein 5; Endoplasmic reticulum resident protein 46; ER protein 46; ERp46; Thioredoxin-like protein p46; TXNDC5; TLP46Host : RabbitSpecies Reactivity: HumanSpecificity…
Product Name : Glycophorin ATarget points: AnokionSwiss Federal Institute of TechnologyStatus: Glycophorin AOrganization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into…
Product Name : Rabbit anti-RBMX Polyclonal Antibody(Center)Synonym : RNA-binding motif protein; X chromosome; Glycoprotein p43; Heterogeneous nuclear ribonucleoprotein G; hnRNP G; N-terminally processed; RBMX; HNRPG; RBMXP1Host : RabbitSpecies Reactivity: HumanSpecificity…
Product Name : Amyloid betaTarget points: Columbia UniversityStatus: Amyloid betaOrganization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies…
Product Name : ACSL5 Monoclonal Antibody (OTI6B5), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI6B5Conjugate : UnconjugatedForm: LyophilizedConcentration : See LabelPurification : Protein A/GStorage buffer: PBS, pH 7.3,…
Product Name : GIPrTarget points: Boehringer IngelheimStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : Rabbit anti-IGFBP1 Polyclonal AntibodySynonym : Insulin-like growth factor-binding protein 1, IBP-1; IGF-binding protein 1, Placental protein 12, PP12Host : RabbitSpecies Reactivity: HumanSpecificity : IGFBP1 Antibody detects endogenous…
Product Name : BDCA-2Target points: AstellasStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Rabbit anti-HOXB5 Polyclonal AntibodySynonym : HGNC:5116; HHO.C10; Homeo box 2A; Homeo box B5; Homeobox 2A; Homeobox B5; Homeobox protein HHO.C10; Homeobox protein Hox B5; Homeobox protein Hox-2A;…
Product Name : IL21RTarget points: AmgenStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : CD20Target points: Academia SinicaStatus: CD20Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : Rabbit anti-EDG4 Polyclonal Antibody(N-term)Synonym : Lysophosphatidic acid receptor 2; LPA receptor 2; LPA-2; Lysophosphatidic acid receptor Edg-4; LPAR2; EDG4; LPA2Host : RabbitSpecies Reactivity: HumanSpecificity : This EDG4…
Product Name : IL-12Interleukin 23Target points: Hengrui PharmaceuticalsStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Product Name : Rabbit anti-CDYL2 Polyclonal AntibodySynonym : Chromodomain Y-like protein 2; CDY-like 2Host : RabbitSpecies Reactivity: Human, Mouse, RatSpecificity : Recognizes endogenous levels of CDYL2 protein.Predicted Reactivity: Applications :…
Product Name : CCL17Target points: GSKStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Product Name : Rabbit anti-PRSS8 Polyclonal AntibodySynonym : CAP1; Channel Activating Protease 1; mCAP1; Prostasin; Prostasin heavy chain; protease; serine; 8; Prss8; PRSS8_HUMAN; Serine protease 8Host : RabbitSpecies Reactivity: Human,…
Product Name : Acidic Protein Rich In LeucinesBAFFTarget points: Alpine Immune SciencesStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the…
Product Name : Ankyrin G Monoclonal Antibody (N106/20), FITCSpecies Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: N106/20Conjugate : FITC View additional formats APC PerCPForm: LiquidConcentration : 1…
Product Name : BCR-ABL-IN-1Description:BCR-ABL-IN-1 is an inhibitor of BCR-ABL tyrosine kinase, with a pIC50 of 6.46, and may be used in the research of chronic myelogenous leukemia.CAS: 188260-50-6Molecular Weight:459.44Formula: C23H21F4N5OChemical…
Product Name : Amphiregulin Monoclonal Antibody (A5)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: A5Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein A/GStorage buffer: PBS with 50%…
Product Name : 6-Thio-2'-DeoxyguanosineDescription:6-Thio-2'-Deoxyguanosine is a nucleoside analogue that can be incorporated into de novo-synthesized telomeres by telomerase.CAS: 789-61-7Molecular Weight:283.31Formula: C10H13N5O3SChemical Name: (2R,3S,5R)-2-(hydroxymethyl)-5-(2-imino-6-sulfanyl-3,9-dihydro-2H-purin-9-yl)oxolan-3-olSmiles : N=C1NC2=C(N=CN22C(O)(CO)O2)C(S)=N1InChiKey: SCVJRXQHFJXZFZ-KVQBGUIXSA-NInChi : InChI=1S/C10H13N5O3S/c11-10-13-8-7(9(19)14-10)12-3-15(8)6-1-4(17)5(2-16)18-6/h3-6,16-17H,1-2H2,(H3,11,13,14,19)/t4-,5+,6+/m0/s1Purity: ≥98% (or…
Product Name : Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) Recombinant Rabbit Monoclonal Antibody (AKR1B1/7009R)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: AKR1B1/7009RConjugate : UnconjugatedForm: LiquidConcentration :…
Product Name : 7-Amino-4-(trifluoromethyl)coumarinDescription:7-Amino-4-(trifluoromethyl)coumarin (Coumarin 151) is a fluorescent marker for the sensitive detection of proteinases. The excitation and emission wavelengths are 400 and 490 nm, respectively.CAS: 53518-15-3Molecular Weight:229.16Formula: C10H6F3NO2Chemical…
Product Name : Ago3 Monoclonal Antibody (4B1-F6)Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: 4B1-F6Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein GStorage buffer: 70mM tris, pH 8,…
Product Name : FonadelparDescription:Fonadelpar is a PPARδ agonist, used in the research of neuroparalytic keratopathy.CAS: 515138-06-4Molecular Weight:504.52Formula: C25H23F3N2O4SChemical Name: 2--1,3-thiazol-5-yl]ethyl-1,2-benzoxazol-6-yl)oxy]acetic acidSmiles : CC1C=C2C(=CC=1OCC(O)=O)ON=C2CCC1SC(=NC=1C(C)C)C1=CC=C(C=C1)C(F)(F)FInChiKey: WWKYLBGQYALEDL-UHFFFAOYSA-NInChi : InChI=1S/C25H23F3N2O4S/c1-13(2)23-21(35-24(29-23)15-4-6-16(7-5-15)25(26,27)28)9-8-18-17-10-14(3)19(33-12-22(31)32)11-20(17)34-30-18/h4-7,10-11,13H,8-9,12H2,1-3H3,(H,31,32)Purity: ≥98% (or refer to…
Product Name : Acetyl-p53 (Lys319) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : L67Description:L67 is a novel, competitive human DNA ligase inhibitor, inhibits DNA ligases I and III with IC50 of 10 μM and 10 μM.IC50 value: 10 μM Target:…
Product Name : AUH Monoclonal Antibody (2G12)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 2G12Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : MK-0354Description:MK-0354 is a partial agonist of GPR109a receptor, for hGPR109a/ mGPR109a with EC50 of 1.65/1.08 μM, showed no activation of GPR109b.IC50 value: 1.65 μM (EC50, for hGPR109a),…
Product Name : ATP6AP1 Monoclonal Antibody (3B11)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 3B11Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Product Name : Gisadenafil besylateDescription:Gisadenafil besylate (UK 369003-26) is a specific, orally active phosphodiesterase 5 (PDE5) inhibitor with an IC50 of 3.6 nM and prevents degradation of cyclic guanosine monophosphate…
Product Name : ATP11C Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 2.22 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : LotamilastDescription:Lotamilast (RVT-501; E6005) is a selective phosphodiesterase 4 (PDE4) inhibitor with an IC50 of 2.8 nM.CAS: 947620-48-6Molecular Weight:472.49Formula: C26H24N4O5Chemical Name: methyl 4-(3-phenylcarbamoyl)benzoateSmiles : CNC1=NC2=CC(OC)=C(C=C2C(=N1)C1=CC(=CC=C1)NC(=O)C1C=CC(=CC=1)C(=O)OC)OCInChiKey: BBTFKAOFCSOZMB-UHFFFAOYSA-NInChi : InChI=1S/C26H24N4O5/c1-27-26-29-20-14-22(34-3)21(33-2)13-19(20)23(30-26)17-6-5-7-18(12-17)28-24(31)15-8-10-16(11-9-15)25(32)35-4/h5-14H,1-4H3,(H,28,31)(H,27,29,30)Purity:…
Product Name : ATG4A Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.27 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : BalapiravirDescription:Balapiravir, also known as R1626 and RO4588161, is a polymerase inhibitor and a tri-isobutyl ester prodrug of R1479, was developed to increase bioavailability and improve antiviral activity.CAS:…
Product Name : ASIC2a Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LyophilizedConcentration : 0.3 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : LCB-2853Description:LCB-2853 is an antagonist of thromboxane A2 (TXA2) receptor, with antiplatelet and antithrombotic activities.CAS: 141335-10-6Molecular Weight:421.94Formula: C21H24ClNO4SChemical Name: 2-cyclopentylmethyl)phenyl]acetic acidSmiles : OC(=O)CC1C=CC(CC2(CNS(=O)(=O)C3C=CC(Cl)=CC=3)CCCC2)=CC=1InChiKey: IKPIVPXMOXMBHT-UHFFFAOYSA-NInChi : InChI=1S/C21H24ClNO4S/c22-18-7-9-19(10-8-18)28(26,27)23-15-21(11-1-2-12-21)14-17-5-3-16(4-6-17)13-20(24)25/h3-10,23H,1-2,11-15H2,(H,24,25)Purity: ≥98% (or…
Product Name : ASB6 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.34 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
Product Name : AZ876Description:AZ876 is a potent and high-affinity LXR agonist. AZ876 displays 25-fold and 2.5-fold more potent than GW3965 (HY-10627) on human (h)LXRα and hLXRβ respectively.CAS: 898800-26-5Molecular Weight:439.57Formula: C24H29N3O3SChemical…
Product Name : ARL13B Polyclonal Antibody, CoraLite® 594Species Reactivity: Dog, Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : CoraLite® 594Form: LiquidConcentration : 0.5 mg/mLPurification : Antigen affinity…
Product Name : 5-Lipoxygenase-In-1Description:5-Lipoxygenase-In-1 is a 5-Lipoxygenase inhibitor extracted from patent EP 331232 A2, table 4, compound example 4.10.CAS: 125235-15-6Molecular Weight:424.56Formula: C23H28N4O2SChemical Name: 1-ethyl-3-4-phenyl-5,5-dimethyl-2-sulfanylideneimidazolidin-4-oneSmiles : CCN1C(=S)N(C(=O)C1(C)C)C1C=CC(=CC=1)N1CCN(CC1)C1C=CC(O)=CC=1InChiKey: AHWDHLCCXRVAIC-UHFFFAOYSA-NInChi : InChI=1S/C23H28N4O2S/c1-4-26-22(30)27(21(29)23(26,2)3)19-7-5-17(6-8-19)24-13-15-25(16-14-24)18-9-11-20(28)12-10-18/h5-12,28H,4,13-16H2,1-3H3Purity: ≥98%…
Product Name : MaltooctaoseDescription:Maltooctaose, a specific-length maltooligosaccharide, can be produced by PFTA (Pyrococcus furiosus).CAS: 66567-45-1Molecular Weight:1315.14Formula: C48H82O41Chemical Name: (2R, 3R, 4R, 5R)-4-oxyoxan-2-yl]oxy-3, 4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3, 4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3, 4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3, 4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3, 4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-2, 3, 5, 6-tetrahydroxyhexanalSmiles…
Product Name : ARHGEF18 Monoclonal Antibody (OTI6D10), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI6D10Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : Oxytocin parallel dimerDescription:Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer.CAS: 19645-28-4Molecular Weight:2014.37Formula: C86H132N24O24S4Chemical Name: (2S)-N-(carbamoylmethyl)-2--10, 33-bis(2-carbamoylethyl)-7, 36-bis(carbamoylmethyl)-39--3-methylbutyl]carbamoylpyrrolidine-1-carbonyl]-16, 27-bis-6, 9, 12, 15, 18, 25, 28, 31, 34,…
Product Name : AQP9 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50%…
Product Name : N-Boc-SBP-0636457-OHDescription:N-Boc-SBP-0636457-OH, a ligand for E3 ubiquitin ligase, is used in the recruitment of IAP E3 ligases. N-Boc-SBP-0636457-OH can be connected to the ligand for Bcl-xL by a…
Product Name : AMY2B Monoclonal Antibody (OTI4B5), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4B5Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
Product Name : BGB-102Description:BGB-102 is a potent multi-kinase inhibitor against EGFR, HER2, and HER4 with IC50s of 9.6 nM, 18 nM and 40.3 nM, respectively.CAS: 807640-87-5Molecular Weight:457.36Formula: C22H25BrN4O2Chemical Name: 5-bromo-18-methoxy-10-methyl-16-oxa-2,10,21,23-tetraazatetracyclopentacosa-1(24),3,5,7,17(25),18,20,22-octaeneSmiles…
Product Name : AMBP Monoclonal Antibody (1E4)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: 1E4Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4Contains…
Product Name : Ilexgenin ADescription:Ilexgenin A is a pentacyclic triterpenoid, which extracted from Ilex hainanensis Merr. Ilexgenin A can be used for the research of inflammation and cancer.CAS: 108524-94-3Molecular Weight:502.68Formula:…
Product Name : ALS2 Monoclonal Antibody (4F10)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 4F10Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4Contains…
Product Name : m-PEG6-2-methylacrylateDescription:m-PEG6-2-methylacrylate is a PEG-based PROTAC linker can be used in the synthesis of PROTACs.CAS: 90784-86-4Molecular Weight:364.43Formula: C17H32O8Chemical Name: 2,5,8,11,14,17-hexaoxanonadecan-19-yl 2-methylprop-2-enoateSmiles : CC(=C)C(=O)OCCOCCOCCOCCOCCOCCOCInChiKey: FVSGBTSAXJGUNZ-UHFFFAOYSA-NInChi : InChI=1S/C17H32O8/c1-16(2)17(18)25-15-14-24-13-12-23-11-10-22-9-8-21-7-6-20-5-4-19-3/h1,4-15H2,2-3H3Purity: ≥98% (or…
Product Name : ALDH1A3 Monoclonal Antibody (OTI4B6), TrueMAB™Species Reactivity: Dog, HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4B6Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : CN128 hydrochlorideDescription:CN128 hydrochloride (CN328) is an orally active and selective iron chelator. CN128 is used for the research of β-thalassemia.CAS: 1335282-05-7Molecular Weight:295.76Formula: C15H18ClNO3Chemical Name: 3-hydroxy-1--2-methyl-1,4-dihydropyridin-4-one; chlorohydrogenSmiles :…
Product Name : AKT1 Monoclonal Antibody (OTI4G4), TrueMAB™Species Reactivity: Dog, Human, Mouse, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4G4Conjugate : Unconjugated View additional formats BiotinForm: liquidConcentration : 1 mg/mLPurification…
Product Name : Androst-4-ene-3, 17-diol, dipropanoate, (3β, 17β)-Description:Androst-4-ene-3,17-diol, dipropanoate, (3β,17β)- is the dipropanoate of 4-Androstenediol, a metabolite of testosterone.CAS: 56699-31-1Molecular Weight:402.57Formula: C25H38O4Chemical Name: (1S,3aS,3bR,7S,9aR,9bS,11aS)-3a,3b,9b-trihydrogenio-9a,11a-dimethyl-7-(propanoyloxy)-1H,2H,3H,3aH,3bH,4H,5H,7H,8H,9H,9aH,9bH,10H,11H,11aH-cyclopentaphenanthren-1-yl propanoateSmiles : C12CC(C=C1CC12CC2(C)1CC2OC(=O)CC)OC(=O)CCInChiKey: AWORKLQNESDOMD-YMKPZFJOSA-NInChi : InChI=1S/C25H38O4/c1-5-22(26)28-17-11-13-24(3)16(15-17)7-8-18-19-9-10-21(29-23(27)6-2)25(19,4)14-12-20(18)24/h15,17-21H,5-14H2,1-4H3/t17-,18-,19-,20-,21-,24-,25-/m0/s1Purity:…
Product Name : AKR7L Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein A, Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : Hosenkoside MDescription:Hosenkoside M is a baccharane glycoside isolated from the seeds of impatiens balsamina.CAS: 161016-51-9Molecular Weight:1111.27Formula: C53H90O24Chemical Name: (2R,3R,4S,5S,6R)-2-oxy-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-1-hydroxy-4a,4b,7,10a-tetramethyl-7-(oxymethyl)-hexadecahydro-1H-spiro-6'-yl]propoxy]-6-(hydroxymethyl)oxane-3,4,5-triolSmiles : C(CO1O(CO)(O)(O)1O)1CC2(CO1)CC1(C)(CC34(C)CC(O5O(CO)(O)(O)5O5OC(O)(O)5O)(C)(CO5O(CO)(O)(O)5O)4CC13C)2OInChiKey: NACOJBQGIGOFFX-FOFPIWDISA-NInChi : InChI=1S/C53H90O24/c1-23(19-69-45-41(66)37(62)34(59)27(16-54)73-45)26-8-13-53(22-71-26)15-14-51(4)24(44(53)68)6-7-31-49(2)11-10-32(76-48-43(39(64)36(61)29(18-56)75-48)77-46-40(65)33(58)25(57)20-70-46)50(3,30(49)9-12-52(31,51)5)21-72-47-42(67)38(63)35(60)28(17-55)74-47/h23-48,54-68H,6-22H2,1-5H3/t23-,24+,25+,26-,27+,28+,29+,30+,31+,32-,33-,34+,35+,36+,37-,38-,39-,40+,41+,42+,43+,44+,45+,46-,47+,48-,49-,50-,51+,52+,53+/m0/s1Purity: ≥98% (or refer…
Product Name : 4933434E20Rik Polyclonal AntibodySpecies Reactivity: MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 2% sucroseContains :…
Product Name : L-LysineDescription:L-lysine is an essential amino acid with important roles in connective tissues and carnitine synthesis, energy production, growth in children, and maintenance of immune functions.CAS: 56-87-1Molecular Weight:146.19Formula:…
Product Name : AF6 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: liquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: tris citrate/phosphate, pH…
Product Name : BlarcamesineDescription:Blarcamesine (AVex-73;AE-37) is an orally bioavailable Sigma-1 receptor agonist and muscarinic receptor modulator, with anticonvulsant, anti-amnesic, neuroprotective and antidepressant properties. Blarcamesine ameliorates neurologic impairments in a mouse…
Product Name : WilforgineDescription:Wilforgine, one of the major bioactive sesquiterpene alkaloids in Tripterygium wilfordii Hook. F., induces microstructural and ultrastructural changes in the muscles of M. separata larvae, and the…
Product Name : G-Protein antagonist peptideDescription:G-Protein antagonist peptide is the substance P-related peptide that inhibits binding of G proteins to their receptors. G-Protein antagonist peptide competitively and reversibly inhibits M2…
Product Name : Br-PEG4-acidDescription:Br-PEG4-acid is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: Molecular Weight:315.16Formula: C10H19BrO6Chemical Name: 14-bromo-3,6,9,12-tetraoxatetradecanoic acidSmiles : OC(=O)COCCOCCOCCOCCBrInChiKey: GNHQMWDLFMWZTA-UHFFFAOYSA-NInChi : InChI=1S/C10H19BrO6/c11-1-2-14-3-4-15-5-6-16-7-8-17-9-10(12)13/h1-9H2,(H,12,13)Purity: ≥98%…
Product Name : Amoxicillin SodiumDescription:Amoxicillin sodium is a broad-spectrum semisynthetic antibiotic similar to AMPICILLIN except that its resistance to gastric acid permits higher serum levels with oral administration.CAS: 34642-77-8Molecular Weight:387.39Formula:…
Product Name : DesoximetasoneDescription:Desoximetasone is a medication belonging to the family of medications known as topical corticosteroids. It is used for the relief of various skin conditions, including rashes. It…
Product Name : Z-Leu-Leu-Leu-vinyl sulfoneSequence: Z-(Leu)3-vinyl sulfonePurity: ≥99%Molecular Weight:~551.3 DaSolubility : Appearance: Use/Stability : As indicated on product label or CoA when stored as recommended.Description: Inhibits the trypsin-like, chymotrypsin-like and…
Product Name : StauprimideDescription:Stauprimide is a selective inhibitor of protein kinase C. It interacts with the NME2 (PUF) transcription factor to down-regulate c-Myc expression, which leads to differentiation of stem…
Product Name : Tick-borne Encephalitis Virus Envelope protein, (recombinant) (mouse Fc-tag)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: Recombinant Tick-borne encephalitis virus (TBEV) protein produced in HEK293 cells, incorporating…
Product Name : Curcumin D6Description:Curcumin D6 (Diferuloylmethane D6) is a deuterium labeled Curcumin (Turmeric yellow). Curcumin (Turmeric yellow) is a natural phenolic compound with diverse pharmacologic effects including anti-inflammatory, antioxidant,…
Product Name : TemozolomideSequence: Purity: ≥98% (HPLC)Molecular Weight:194.2Solubility : Soluble in DMSO; slightly soluble in water.Appearance: White to off-white crystalline powder.Use/Stability : As indicated on product label or CoA when…
Product Name : SID 3712249Description:SID 3712249 (MiR-544 Inhibitor 1) is an inhibitor of the biogenesis of microRNA-544 (miR-544). Target: MiR-544 MiR-544 represses expression of mTOR, promoting tumor cell survival in…
Product Name : RANKL (total), soluble (human) ELISA kitSequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: The RANKL (total), soluble (human) ELISA kit is a complete assay for the…
Product Name : Proteasome 20S assay kitSequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: A QUANTIZYME® Assay System. Fluorogenic, non-radioactive assay designed to measure chymotrypsin-like protease activity of purified…
Product Name : Sanguinarine chlorideDescription:Sanguinarine (Sanguinarin) chloride, a benzophenanthridine alkaloid derived from the root of Sanguinaria Canadensis, can stimulate apoptosis via activating the production of reactive oxygen species (ROS). Sanguinarine-induced…
Product Name : Polyubiquitin (K63-linkage-specific) monoclonal antibody (HWA4C4)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: Key antibody for the detection of K63-linked polyubiquitinylated proteins. Modification of proteins by addition…
Product Name : Phosphatidic acid, dioleoylSequence: Purity: ≥98% (GC)Molecular Weight:724Solubility : Soluble in chloroform.Appearance: White powder.Use/Stability : As indicated on product label or CoA when stored as recommended.Description: PKC activator…
Product Name : PDI monoclonal antibody (1D3) (PE conjugate)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: The mammalian protein disulphide-isomerase (PDI) family encompasses several highly divergent proteins involved in…
Product Name : β-Histine-d3Description:Product informationCAS: 244094-70-0Molecular Weight:139.21Formula: C8H12N2Chemical Name: (²H₃)methylamineSmiles : C()()NCCC1=CC=CC=N1InChiKey: UUQMNUMQCIQDMZ-FIBGUPNXSA-NInChi : InChI=1S/C8H12N2/c1-9-7-5-8-4-2-3-6-10-8/h2-4,6,9H,5,7H2,1H3/i1D3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as non-hazardous…
Product Name : ODN 1826 (TLRGRADE®) (synthetic) (BULK)Sequence: 5’-tccatgacgttcctgacgtt-3’ (lower case letters indicate phosphorothioate linkage).Purity: Molecular Weight:6383 (ammonium salt)Solubility : Appearance: Use/Stability : As indicated on product label or CoA when…
Product Name : NGAL (monkey) monoclonal antibody (68) (biotin conjugate)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: Neutrophil gelatinase-associated lipocalin (NGAL; also called lipocalin 2, siderocalin and neutrophil lipocalin)…
Product Name : Nerve growth factor 7S (mouse)Sequence: Purity: ≥98% (HPLC)Molecular Weight:~130kDa.Solubility : Appearance: Use/Stability : As indicated on product label or CoA when stored as recommended. Stable for 2-3…
Product Name : (S)-Citalopram N-oxide hydrochlorideDescription:Product informationCAS: 1217710-65-0Molecular Weight:346.43Formula: C20H21FN2O2Chemical Name: 3--N,N-di(²H₃)methylpropanamine oxideSmiles : C()()()(CCC1(OCC2=CC(=CC=C12)C#N)C1C=CC(F)=CC=1)C()()InChiKey: DIOGFDCEWUUSBQ-PVKQDMRYSA-NInChi : InChI=1S/C20H21FN2O2/c1-23(2,24)11-3-10-20(17-5-7-18(21)8-6-17)19-9-4-15(13-22)12-16(19)14-25-20/h4-9,12H,3,10-11,14H2,1-2H3/t20-/m0/s1/i1D3,2D3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient…
Product Name : MMP-1 proenzyme (human fibroblasts)Sequence: Purity: ≥90% (SDS-PAGE, Western blot)Molecular Weight:~56kDa.Solubility : Appearance: Use/Stability : As indicated on product label or CoA when stored as recommended.Description: MMP-1, the…
Product Name : Leukotriene C4Sequence: Purity: ≥95% (HPLC)Molecular Weight:625.8Solubility : Appearance: Colorless solution.Use/Stability : As indicated on product label or CoA when stored as recommended. Stable for at least 1…
Product Name : DRI-C21045Description:DRI-C21045 (compound 10) is a potent and selective inhibitor of the CD40-CD40L costimulatory protein-protein interaction (PPI) with an IC50 of 0.17 µM. DRI-C21045 shows concentration-dependent inhibition of…
Product Name : L-Glutathione (oxidized form)Sequence: Purity: ≥95.0% (HPLC)Molecular Weight:612.{{862111-32-8} site|{862111-32-8} Technical Information|{862111-32-8} Data Sheet|{862111-32-8} supplier} 6Solubility : Soluble in water.{{929904-85-8} site|{929904-85-8} Biological Activity|{929904-85-8} Formula|{929904-85-8} supplier} Appearance: White solid.Use/Stability :…
Product Name : Hydrogen peroxide fluorometric detection kitSequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: Flexible – measure hydrogen peroxide or peroxidase activityHigher throughput – one step homogeneous mix-and-read…
Product Name : RORγt agonist 1Description:RORγt agonist 1 (compound 14) is a potent, orally bioavailable RORγt agonist with an EC50 of 20.8 nM. RORγt agonist 1 showes high metabolic stability, improved…
Product Name : CevidoplenibDescription:Cevidoplenib is an orally available inhibitor of spleen tyrosine kinase (Syk), with potential anti-inflammatory and immunomodulating activities.CAS: 1703788-21-9Molecular Weight:473.53Formula: C25H27N7O3Chemical Name: (4S)-2-pyrimidin-4-yl}-3-methyl-1H-pyrazol-4-yl)methyl]-1,2-oxazolidin-4-olSmiles : CN1C=C(C(=O)C2CC2)C2=CC(=CC=C12)NC1=NC=CC(=N1)N1C=C(CN2C(O)CO2)C(C)=N1InChiKey: YCZUBLQESBVOSH-IBGZPJMESA-NInChi : InChI=1S/C25H27N7O3/c1-15-17(10-31-12-19(33)14-35-31)11-32(29-15)23-7-8-26-25(28-23)27-18-5-6-22-20(9-18)21(13-30(22)2)24(34)16-3-4-16/h5-9,11,13,16,19,33H,3-4,10,12,14H2,1-2H3,(H,26,27,28)/t19-/m0/s1Purity:…
Product Name : (R)-ZanubrutinibDescription:(R)-Zanubrutinib is the R enantiomer of Zanubrutinib. Zanubrutinib is a selective Bruton tyrosine kinase (BTK) inhibitor.CAS: 1691249-44-1Molecular Weight:471.55Formula: C27H29N5O3Chemical Name: (7R)-2-(4-phenoxyphenyl)-7--4H,5H,6H,7H-pyrazolopyrimidine-3-carboxamideSmiles : C=CC(=O)N1CCC(CC1)1CCNC2=C(C(N)=O)C(=NN21)C1C=CC(=CC=1)OC1C=CC=CC=1InChiKey: RNOAOAWBMHREKO-JOCHJYFZSA-NInChi : InChI=1S/C27H29N5O3/c1-2-23(33)31-16-13-18(14-17-31)22-12-15-29-27-24(26(28)34)25(30-32(22)27)19-8-10-21(11-9-19)35-20-6-4-3-5-7-20/h2-11,18,22,29H,1,12-17H2,(H2,28,34)/t22-/m1/s1Purity: ≥98%…
Product Name : FlutriafolDescription:Flutriafol is a triazole fungicide with broad spectrum fungicidal activity.CAS: 76674-21-0Molecular Weight:301.29Formula: C16H13F2N3OChemical Name: 1-(2-fluorophenyl)-1-(4-fluorophenyl)-2-(1H-1,2,4-triazol-1-yl)ethan-1-olSmiles : OC(CN1C=NC=N1)(C1=CC=CC=C1F)C1C=CC(F)=CC=1InChiKey: JWUCHKBSVLQQCO-UHFFFAOYSA-NInChi : InChI=1S/C16H13F2N3O/c17-13-7-5-12(6-8-13)16(22,9-21-11-19-10-20-21)14-3-1-2-4-15(14)18/h1-8,10-11,22H,9H2Purity: ≥98% (or refer to the Certificate of…
Product Name : N-Hexadecylpyrene-1-sulfonamideSynonym: HDPSA , N-(Pyrene-1-sulfonyl)hexadecylamineCAS : 351002-71-6Molecular formula:C32H43NO2SMolecular Weight : 505.{{254750-02-2} site|{254750-02-2} Purity & Documentation|{254750-02-2} In Vivo|{254750-02-2} custom synthesis} 75Purity: ≥90% (TLC)Specifications: Purity ≥90% (TLC)|Appearance White to off-white…
Product Name : XylotetraoseDescription:Xylotetraose is a hydrolysis product of Xylan. Xylan is a polysaccharide made from units of xylose and contains predominantly β-D-xylose units linked as in cellulose. Xylotetraose can…
Product Name : HeptenophosSynonym: Ragadan , XOE 2982 , 7-Chlorobicyclohepta-2,6-dien-6-yl dimethyl phosphateCAS : 23560-59-0Molecular formula:C9H12ClO4PMolecular Weight : 250Purity: ≥98% (HPLC)Specifications: Purity ≥98% (HPLC)|Appearance Light yellow to very dark yellow solid|Identity…
Product Name : DAR-2T solution (5 mM in DMSO)Synonym: Diaminorhodamine-2TCAS : 261351-48-8Molecular formula:C28H29N5O3Molecular Weight : 483.6Purity: ≥90% (NMR)Specifications: Purity ≥90% (NMR)|Appearance Liquid|Identity 1H-NMR|PropertiesSolvents DMSO|{{83883-10-7} MedChemExpress|{83883-10-7} Purity & Documentation|{83883-10-7} In Vivo|{83883-10-7}…
Product Name : Piericidin ADescription:Piericidin A (AR-054) is a natural mitochondrial NADH-ubiquinone oxidoreductase (complex I) inhibitor. Piericidin A is a potent neurotoxin and inhibits mitochondrial respiration by disrupting the electron…
Product Name : Boc-GABA-OHDescription:Boc-GABA-OH is a PROTAC linker which can be used to synthesis UNC6852, an EED-targeted PROTAC.CAS: 57294-38-9Molecular Weight:203.24Formula: C9H17NO4Chemical Name: 4-{amino}butanoic acidSmiles : CC(C)(C)OC(=O)NCCCC(O)=OInChiKey: HIDJWBGOQFTDLU-UHFFFAOYSA-NInChi : InChI=1S/C9H17NO4/c1-9(2,3)14-8(13)10-6-4-5-7(11)12/h4-6H2,1-3H3,(H,10,13)(H,11,12)Purity: ≥98%…
Product Name : AzimsulfuronSynonym: N-{carbonyl}-1-methyl-4-(2-methyl-H-tetrazol-5-yl)-1H-pyrazole-5-sulfonamideCAS : 120162-55-2Molecular formula:C13H16N10O5SMolecular Weight : 424.{{1797432-62-2} web|{1797432-62-2} Purity & Documentation|{1797432-62-2} Formula|{1797432-62-2} supplier} 4Purity: ≥98% (HPLC)Specifications: Purity ≥98% (HPLC)|Appearance Solid|Identity 1H-NMR|PropertiesSolvents acetonitrile|Melting Point 169 - 176…
Product Name : 5(6)-Amino-TAMRASynonym: 5(6)-AminotetramethylrhodamineCAS : 123379-86-2Molecular formula:C24H23N3O3Molecular Weight : 401.{{52232-67-4} medchemexpress|{52232-67-4} Technical Information|{52232-67-4} Purity|{52232-67-4} supplier} 5Purity: ≥98% (HPLC)Specifications: Purity ≥98% (HPLC)|Appearance Red powder|Identity 1H-NMR|PropertiesSolvents DMSO, methanol|{{2765082-12-8} site|{2765082-12-8} Purity &…
Product Name : PseudojervineDescription:Pseudojervine is a glycoalkaloid with a feeble inhibition activity against platelet aggregation.CAS: 36069-05-3Molecular Weight:587.74Formula: C33H49NO8Chemical Name: (3S,3'R,3'aS,6'S,6aS,6bS,7'aR,9R,11aS,11bR)-3',6',10,11b-tetramethyl-3-{oxy}-1,2,3,3'a,4,4',5',6,6',6a,6b,7,7',7'a,8,11,11a,11b-octadecahydro-3'H-spirofluorene-9,2'-furopyridin]-11-oneSmiles : C12CC(CC1=CC12C(=O)C21CC1(O3C(C)CN31C)C=2C)O1O(CO)(O)(O)1OInChiKey: HYDDDNUKNMMWBD-VPLHBGEQSA-NInChi : InChI=1S/C33H49NO8/c1-15-11-22-26(34-13-15)17(3)33(42-22)10-8-20-21-6-5-18-12-19(40-31-30(39)29(38)27(36)23(14-35)41-31)7-9-32(18,4)25(21)28(37)24(20)16(33)2/h5,15,17,19-23,25-27,29-31,34-36,38-39H,6-14H2,1-4H3/t15-,17+,19-,20-,21-,22+,23+,25+,26-,27+,29-,30+,31+,32-,33-/m0/s1Purity: ≥98% (or refer to the…
Product Name : 7-MethylguanosineDescription:7-Methylguanosine is a novel cNIIIB nucleotidase inhibitor with IC50 value of 87.8 ± 7.5 µM.CAS: 20244-86-4Molecular Weight:298.28Formula: C11H16N5O5Chemical Name: 2-amino-9--7-methyl-6-oxo-6,7-dihydro-1H-9λ⁵-purin-9-yliumSmiles : CN1C=(2O(CO)(O)2O)C2N=C(N)NC(=O)C1=2InChiKey: OGHAROSJZRTIOK-KQYNXXCUSA-OInChi : InChI=1S/C11H15N5O5/c1-15-3-16(8-5(15)9(20)14-11(12)13-8)10-7(19)6(18)4(2-17)21-10/h3-4,6-7,10,17-19H,2H2,1H3,(H2-,12,13,14,20)/p+1/t4-,6-,7-,10-/m1/s1Purity: ≥98% (or refer to the…
Product Name : Anti-Mouse IgG, AlpSdAbs® VHH(VcPBD ×8)Applications: Internalization TestReactivity : Mouse IgGConjugate:Advantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-Mouse IgG, AlpSdAbs® VHH(VcPBD ×8) is…
Product Name : Disitertide TFADescription:Disitertide (P144) TFA is a peptidic transforming growth factor-beta 1 (TGF-β1) inhibitor specifically designed to block the interaction with its receptor. Disitertide (P144) TFA is also…
Product Name : L-Lysine-13C6,15N2,d9 dihydrochlorideCAS No.: 1994268-57-3Purity : > 99%Shipping:Shipped on dry ice.Storage : Please store the product under the recommended conditions in the Certificate of Analysis.SMILES: Product Description :…
Product Name : Anti-Rabbit IgG for WB, AlpSdAbs® VHH(HRP)Applications: WBReactivity : Rabbit IgG(H&L)Conjugate:HRPAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-Rabbit IgG for WB, AlpSdAbs® VHH(HRP)…
Product Name : Protosappanin ADescription:Protosappanin A (PTA), an immunosuppressive ingredient and major biphenyl compound isolated from Caesalpinia sappan L, suppresses JAK2/STAT3-dependent inflammation pathway through down-regulating the phosphorylation of JAK2 and…
Product Name : Boc-NH-PEG3Description:Boc-NH-PEG3 (PROTAC Linker 10) is a PEG-based PROTAC linker can be used in the synthesis of PROTACs.CAS: 139115-92-7Molecular Weight:249.30Formula: C11H23NO5Chemical Name: tert-butyl N-{2-ethyl}carbamateSmiles : CC(C)(C)OC(=O)NCCOCCOCCOInChiKey: FMLOTGGIHAYZLW-UHFFFAOYSA-NInChi :…
Product Name : Anti-SIGLEC3/CD33(Vadastuximab Biosimilar) AntibodyApplications: ELISA,Flow CytReactivity : Human SIGLEC3/CD33/p67Conjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-SIGLEC3/CD33(Vadastuximab Biosimilar) Antibody is a biosimilar antibody directed…
Product Name : Anti-IL5(Mepolizumab Biosimilar) AntibodyApplications: ELISA,Flow CytReactivity : Human IL5Conjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-IL5(Mepolizumab Biosimilar) Antibody is a biosimilar antibody directed…
Product Name : Brinzolamide-d5Description:Product informationCAS: 1217651-02-9Molecular Weight:388.54Formula: C12H21N3O5S3Chemical Name: (4R)-4-{amino}-2-(3-methoxypropyl)-1,1-dioxo-2H,3H,4H-1λ⁶-thienothiazine-6-sulfonamideSmiles : C()()C()()N1CN(CCCOC)S(=O)(=O)C2SC(=CC=21)S(N)(=O)=OInChiKey: HCRKCZRJWPKOAR-RQTACTIOSA-NInChi : InChI=1S/C12H21N3O5S3/c1-3-14-10-8-15(5-4-6-20-2)23(18,19)12-9(10)7-11(21-12)22(13,16)17/h7,10,14H,3-6,8H2,1-2H3,(H2,13,16,17)/t10-/m0/s1/i1D3,3D2Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as non-hazardous…
Product Name : Anti-IGHE(Quilizumab Biosimilar) AntibodyApplications: ELISA,Flow CytReactivity : Human IGHEConjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-IGHE(Quilizumab Biosimilar) Antibody is a biosimilar antibody directed…
Product Name : Anti-GFP, AlpSdAbs® VHH(iFluor488)Applications: ELISA,ICC/IF,Flow CytReactivity : GFPConjugate:iFluor488Advantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-GFP, AlpSdAbs® VHH(iFluor488) is designed for detecting GFP fusion…
Product Name : 6-Hydroxypyridin-2(1H)-one hydrochlorideDescription:6-Hydroxypyridin-2(1H)-one hydrochloride is an endogenous metabolite.CAS: 10357-84-3Molecular Weight:147.56Formula: C5H6ClNO2Chemical Name: 6-hydroxy-1,2-dihydropyridin-2-one hydrochlorideSmiles : Cl.{{RIPA Lysis Buffer} MedChemExpress|{RIPA Lysis Buffer} Immunology/Inflammation|{RIPA Lysis Buffer} Protocol|{RIPA Lysis Buffer} Formula|{RIPA…
Product Name : Anti-Human GSN, AlpSdAbs® VHHApplications: ELISA,IFReactivity : Human GSNConjugate:UnconjugatedAdvantages : High lot-to-lot consistencyAnimal-free productionDescription: | Description: Anti-Human GSN, AlpSdAbs® VHH is designed for detecting Human GSN, and Anti-Human…
Product Name : Anti-Human CCL2/MCP-1, AlpSdAbs® VHHApplications: ELISAReactivity : Human CCL2/MCP-1Conjugate:UnconjugatedAdvantages : High lot-to-lot consistencyAnimal-free productionDescription: | Description: Anti-Human CCL2/MCP-1, AlpSdAbs® VHH is designed for detecting Human CCL2/MCP-1, and Anti-Human…
Product Name : Streptavidin(iFluor647)Applications: ELISA,WB,Flow CytReactivity : BiotinConjugate:iFluor647Advantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Streptavidin(iFluor647) is coupled steptavidin with iFluor647. Streptavidin(iFluor647) is highly sensitive to…
Product Name : MRT00033659Description:MRT00033659 is a potent broad-spectrum kinase inhibitor of CK1 (IC50=0.9 µM for CK1δ) and CHK1 (IC50=0.23 µM). MRT00033659, a pyrazolo-pyridine analogue, induces p53 pathway activation and E2F-1…
Product Name : Anti-Human IgG(Fcγ Fragment specific), Goat antibodyApplications: WB,ICC/IF,ELISA,IP,Flow CytReactivity : Human IgG(Fcγ Fragment specific)Conjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-Human IgG(Fcγ Fragment…
Product Name : Anti-TfR1, Human antibodyApplications: ELISA,Flow CytReactivity : HumanConjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-TfR1, Human antibody is designed for detecting human TfR1…
Product Name : Anti-IFNA1, Human antibodyApplications: ELISA,Flow CytReactivity : HumanConjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-IFNA1, Human antibody is designed for detecting human IFNA1…
Product Name : RosavinDescription:Rosavin is isolated from R. rosea, Rosavin shows antidepressant-like, adaptogenic, anxiolytic-like effects in mice model.CAS: 84954-92-7Molecular Weight:428.43Formula: C20H28O10Chemical Name: (2R,3R,4S,5S,6R)-2-{oxy}-6-({oxy}methyl)oxane-3,4,5-triolSmiles : O1CO(OC2O(OC/C=C/C3C=CC=CC=3)(O)(O)2O)(O)1OInChiKey: RINHYCZCUGCZAJ-IPXOVKFZSA-NInChi : InChI=1S/C20H28O10/c21-12-9-28-19(17(25)14(12)22)29-10-13-15(23)16(24)18(26)20(30-13)27-8-4-7-11-5-2-1-3-6-11/h1-7,12-26H,8-10H2/b7-4+/t12-,13+,14-,15+,16-,17+,18+,19-,20+/m0/s1Purity: ≥98% (or…
Product Name : GW7647CAS No.: 265129-71-3Purity : > 99%Shipping:Shipped on dry ice.Storage : Store at Room Temperature. The product can be stored for up to 12 months.SMILES: O=C(NC1CCCCC1)N(CCc2ccc(SC(C)(C)C(=O)O)cc2)CCCCC3CCCCC3Product Description :…
Product Name : DX600 TFACAS No.: Purity : 99.94%Shipping:Room temperature in the continental U.S. Other areas may vary.Storage : In solvent: -80°C, 6 months; -20°C, 1 month (sealed storage, away…
Product Name : Ralaniten triacetateDescription:Ralaniten triacetate (EPI-506), the pro-drug of Ralaniten, is a first-in-class, orally active androgen receptor (AR) N-terminal domain (NTD) inhibitor. Ralaniten triacetate shows activity against both full…
Product Name : CurcuminCAS No.: 458-37-7Purity : > 98%Shipping:Shipped on dry ice.Storage : Store at -20 °C. Store under desiccating conditions. The product can be stored for up to 12…
Product Name : 1-Deoxynojirimycin hydrochlorideCAS No.: 73285-50-4Purity : > 99%Shipping:Shipped on dry ice.Storage : Protect from light.Powder: -80 °C, 2 years; -20 °C, 1 year.In solvent: -80 °C, 6 months;…
Product Name : Thiol-PEG6-acidDescription:Thiol-PEG6-acid is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 1347750-77-9Molecular Weight:370.46Formula: C15H30O8SChemical Name: 1-sulfanyl-3,6,9,12,15,18-hexaoxahenicosan-21-oic acidSmiles : OC(=O)CCOCCOCCOCCOCCOCCOCCSInChiKey: RSFZNXGXOCUHLT-UHFFFAOYSA-NInChi : InChI=1S/C15H30O8S/c16-15(17)1-2-18-3-4-19-5-6-20-7-8-21-9-10-22-11-12-23-13-14-24/h24H,1-14H2,(H,16,17)Purity: ≥98%…
Product Name : umbralisib (TGR-1202)CAS No.: 1532533-67-7Purity : > 99%Shipping:Shipped on dry ice.Storage : Powder: -20 °C, 3 years; 4 °C, 2 yearsIn solvent: -80 °C, 6 months; -20 °C,…
Product Name : DBPR112Description:DBPR112 is an orally active furanopyrimidine-based EGFR inhibitor with IC50s of 15 nM and 48 nM for EGFRWT and EGFRL858R/T790M, respectively. DBPR112 can occupy the ATP-binding site.…
Product Name : DO-264Description:DO-264 is a selective and in vivo-active inhibitor of Abhydrolase Domain Containing 12 (ABHD12), with an IC50 of 11 nM.CAS: 2301866-59-9Molecular Weight:558.40Formula: C23H20Cl2F3N5O2SChemical Name: 3-(1-{3-chloro-4-pyridin-2-yl}piperidin-4-yl)-1-(pyridin-3-yl)thioureaSmiles : FC(F)(F)OC1=CC(Cl)=C(C=C1)OC1=CC=NC(=C1Cl)N1CCC(CC1)NC(=S)NC1=CN=CC=C1InChiKey:…
Product Name : ALC-0159Description:ALC-0159, a polyethylene glycol (PEG) lipid conjugate, could be used as vaccine excipient.CAS: 1849616-42-7Molecular Weight:542.92Formula: C33H70N2O3Chemical Name: 2-(2-methoxyethoxy)-N,N-ditetradecylacetamide amineSmiles : N.COCCOCC(=O)N(CCCCCCCCCCCCCC)CCCCCCCCCCCCCCInChiKey: XRINHCGBBXKJPI-UHFFFAOYSA-NInChi : InChI=1S/C33H67NO3.H3N/c1-4-6-8-10-12-14-16-18-20-22-24-26-28-34(33(35)32-37-31-30-36-3)29-27-25-23-21-19-17-15-13-11-9-7-5-2;/h4-32H2,1-3H3;1H3Purity: ≥98% (or refer…
Product Name : cis-Ned 19Description:Product informationCAS: 1137264-00-6Molecular Weight:514.59Formula: C30H31FN4O3Chemical Name: (1S,3S)-1-(3-{methyl}-4-methoxyphenyl)-1H,2H,3H,4H,9H-pyridoindole-3-carboxylic acidSmiles : COC1C=CC(=CC=1CN1CCN(CC1)C1=CC=CC=C1F)1N(CC2=C1NC1=CC=CC=C21)C(O)=OInChiKey: FUHCEERDBRGPQZ-LSYYVWMOSA-NInChi : InChI=1S/C30H31FN4O3/c1-38-27-11-10-19(16-20(27)18-34-12-14-35(15-13-34)26-9-5-3-7-23(26)31)28-29-22(17-25(33-28)30(36)37)21-6-2-4-8-24(21)32-29/h2-11,16,25,28,32-33H,12-15,17-18H2,1H3,(H,36,37)/t25-,28-/m0/s1Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
Product Name : (±)-Epinephrine (hydrochloride)Description:(±)-Epinephrine is a natural neurotransmitter that is released from the adrenal medulla and activates adrenoceptors (Kis = 15, 735, and 3,970 nM for α1A-, β2-, and…
Product Name : CarazololDescription:Carazolol is a high-affinity, lipophilic, and non-selective ligand of the β-adrenergic receptors . β-adrenergic receptors have been involved in mediating the physiological responses of the catecholamines, epinephrine…
Product Name : PD 198306Description:IC50: 8 nM for MEK PD 198306 is a potent, selective and non-ATP competitive MAPK/ERK-kinase (MEK) inhibitor. MEK is a kinase enzyme which phosphorylates mitogen-activated protein…
Product Name : CGP 20712 dihydrochlorideDescription:CGP 20712 dihydrochloride is a potent and selective antagonist of β1-adrenoceptor with IC50 value of 0.7 nM . β1-adrenoceptor is a G-protein coupled receptor and…
Product Name : Ro 67-4853Description:Product informationCAS: 302841-89-0Molecular Weight:325.36Formula: C19H19NO4Chemical Name: butyl N-(9H-xanthene-9-carbonyl)carbamateSmiles : CCCCOC(=O)NC(=O)C1C2=CC=CC=C2OC2=CC=CC=C21InChiKey: RQBUXEUMZZQUFY-UHFFFAOYSA-NInChi : InChI=1S/C19H19NO4/c1-2-3-12-23-19(22)20-18(21)17-13-8-4-6-10-15(13)24-16-11-7-5-9-14(16)17/h4-11,17H,2-3,12H2,1H3,(H,20,21,22)Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
Product Name : Germicidin BDescription:Germicidin is a pyranone antibiotic originally excreted by Streptomyces viridochromogenes NRRL B-1551. Germicidin has an inhibitory effect on the germination of its own arthrospores at a…
Product Name : Procyclidine hydrochlorideDescription:Procyclidine hydrochloride is a potent anti-cholinergic agent, and is also known to have NMDA antagonist properties.CAS: 1508-76-5Molecular Weight:323.90Formula: C19H30ClNOChemical Name: 1-cyclohexyl-1-phenyl-3-(pyrrolidin-1-yl)propan-1-ol hydrochlorideSmiles : Cl.OC(CCN1CCCC1)(C1CCCCC1)C1C=CC=CC=1InChiKey: ZFSPFXJSEHCTTR-UHFFFAOYSA-NInChi :…
Product Name : Veledimex (S enantiomer)Description:Veledimex S enantiomer (INXN-1001 S enantiomer) is the S enantiomer of veledimex. Veledimex is an oral activator ligand for a proprietary gene therapy promoter system,…
Product Name : Concanamycin ADescription:Concanamycin A (Antibiotic X 4357B) is a macrolide antibiotic and a specific vacuolar type H+-ATPase (V-ATPase) inhibitor.CAS: 80890-47-7Molecular Weight:866.09Formula: C46H75NO14Chemical Name: 6-({2--2-hydroxy-5-methyl-6-(prop-1-en-1-yl)oxan-4-yl}oxy)-4-hydroxy-2-methyloxan-3-yl carbamateSmiles : CC=CC1OC(O)(CC(OC2CC(O)C(OC(N)=O)C(C)O2)C1C)C(C)C(O)C(C)C1OC(=O)C(=CC(C)=CC(C)C(O)C(CC)C(O)C(C)CC(C)=CC=CC1OC)OCInChiKey: DJZCTUVALDDONK-VFFQJYFESA-NInChi…
Product Name : (E)-Ethyl p-methoxycinnamateDescription:(E)-Ethyl p-methoxycinnamate is a natural product found in Kaempferia galangal with anti-inflammatory, anti-neoplastic and anti-microbial effects. (E)-Ethyl p-methoxycinnamate inhibits COX-1 and COX-2 in vitro with IC50s…
Product Name : CD73-IN-1Description:CD73-IN-1 is an inhibitor of CD73 which can be used in the treatment of cancer extracted from patent WO 2017153952 A1, example 80.CAS: 2132396-40-6Molecular Weight:371.41Formula: C18H17N3O4SChemical Name:…
Product Name : (Z)-9-PropenyladenineDescription:(Z)-9-Propenyladenine is a mutagenic impurity in tenofovir disoproxil fumarate. Tenofovir is an antiretroviral drug known as nucleotide analogue reverse transcriptase (NtART) inhibitor, which blocks reverse transcriptase, a…
Product Name : (Z)-MirinDescription:Mirin is a small-molecule inhibitor of MRN (Mre11, Rad50, and Nbs1) complex.Target: in vitro: Mirin was shown to block Mre11 exonuclease activity and MRN-dependent ATM activation, and…
Product Name : KRas G12C inhibitor 1Description:KRas G12C inhibitor 1 is a compound that inhibits KRas G12C, extracted from patent US 20180072723 A1.CAS: 2158297-28-8Molecular Weight:542.67Formula: C31H38N6O3Chemical Name: 1-methoxy}-5H,6H,7H,8H-pyridopyrimidin-4-yl]-3-methylpiperazin-1-yl]prop-2-en-1-oneSmiles : CN1CCC1COC1N=C2CN(CCC2=C(N=1)N1CCN(C1C)C(=O)C=C)C1C=C(O)C=C2C=CC=CC2=1InChiKey:…
Product Name : (R)-UT-155Description:(R)-UT-155 (compound 11) is a selective androgen receptor degrader (SARD) ligand. Less active than the S-isomer.CAS: 2031161-54-1Molecular Weight:405.35Formula: C20H15F4N3O2Chemical Name: (2R)-N--3-(5-fluoro-1H-indol-1-yl)-2-hydroxy-2-methylpropanamideSmiles : C(O)(CN1C=CC2=CC(F)=CC=C12)C(=O)NC1C=C(C(=CC=1)C#N)C(F)(F)FInChiKey: CFSAYQVTXBMPRF-LJQANCHMSA-NInChi : InChI=1S/C20H15F4N3O2/c1-19(29,11-27-7-6-12-8-14(21)3-5-17(12)27)18(28)26-15-4-2-13(10-25)16(9-15)20(22,23)24/h2-9,29H,11H2,1H3,(H,26,28)/t19-/m1/s1Purity: ≥98%…
Product Name : MAC13243Description:MAC13243 is an antibacterial agent. MAC13243 inhibits the function of the LolA protein and represents a new chemical probe of lipoprotein targeting in bacteria with promise as…
Product Name : EtifoxineDescription:Etifoxine is a positive allosteric modulator of α1β2γ2 and α1β3γ2 subunit-containing GABAA receptors.CAS: 21715-46-8Molecular Weight:300.78Formula: C17H17ClN2OChemical Name: N-(6-chloro-4-methyl-4-phenyl-2,4-dihydro-1H-3,1-benzoxazin-2-ylidene)ethan-1-amineSmiles : CCN=C1NC2=CC=C(Cl)C=C2C(C)(O1)C1C=CC=CC=1InChiKey: IBYCYJFUEJQSMK-UHFFFAOYSA-NInChi : InChI=1S/C17H17ClN2O/c1-3-19-16-20-15-10-9-13(18)11-14(15)17(2,21-16)12-7-5-4-6-8-12/h4-11H,3H2,1-2H3,(H,19,20)Purity: ≥98% (or refer to…
Product Name : DioscinDescription:Dioscin is a steroid saponin found in many varieties of Discorea. Dioscin is an anti-cancer and anti-fungal phytochemical that has been shown to induce reactive oxygen-mediated apoptosis…
Product Name : Vinorelbine (ditartrate)Description:Vinorelbine is a semisynthetic vinca alkaloid derived from the leaves of the periwinkle plant (Vinca rosea) with antineoplastic activity. Vinorelbine binds to tubulin, thereby inhibiting tubulin…
Product Name : LevetiracetamDescription:Levetiracetam is a medication used to treat epilepsy. It is the S-enantiomer of etiracetam. Levetiracetam is used for partial onset, myoclonic, or tonic-clonic seizures.CAS: 102767-28-2Molecular Weight:170.21Formula: C8H14N2O2Chemical…
Product Name : L-(-)-α-MethyldopaDescription:LIT-927 is a Locally and Orally Active CXCL12 Neutraligand with Anti-inflammatory Effect in a Murine Model of Allergic Airway Hypereosinophilia. displays a higher solubility. LIT-927 reduces eosinophil…
Product Name : Ginkgolide ADescription:Ginkgolide A is GSK-3β inhibitor and potential PXR agonist found in Ginkgo. It decreases phosphorylation of Tau protein, prevents neointimal hyperplasia and decreases anxiety.CAS: 15291-75-5Molecular Weight:408.40Formula:…
Product Name : SNPB-sulfo-MeDescription:SNPB-sulfo-Me is a cleavable linker that is used for making antibody-drug conjugate (ADC).CAS: 890409-86-6Molecular Weight:449.48Formula: C14H15N3O8S3Chemical Name: 3-methanesulfonyl-2,5-dioxopyrrolidin-1-yl 4-butanoateSmiles : CS(=O)(=O)C1CC(=O)N(OC(=O)CCCSSC2=CC=C(C=N2)()=O)C1=OInChiKey: RIXGLVALRPRFJK-UHFFFAOYSA-NInChi : InChI=1S/C14H15N3O8S3/c1-28(23,24)10-7-12(18)16(14(10)20)25-13(19)3-2-6-26-27-11-5-4-9(8-15-11)17(21)22/h4-5,8,10H,2-3,6-7H2,1H3Purity: ≥98% (or refer…
Product Name : (-)-CurineDescription:(-)-Curine is an orally active bisbenzylisoquinoline alkaloid isolated from Chondrodendron platyphyllum. (-)-Curine presents anti-inflammatory and analgesic effects at nontoxic doses, at least in part, resulting from the…
Product Name : Mogroside III A2Description:Mogroside III A2 is a cucurbitane glycoside. Mogroside III A2 can inhibit Epstein-Barr virus early antigen (EBV-EA) activation. Mogroside III A2 shows weak inhibitory effects…
Product Name : Irinotecan-d10Description:Irinotecan-d10 ((+)-Irinotecan-d10) is a deuterium labeled Irinotecan ((+)-Irinotecan). Irinotecan ((+)-Irinotecan) is a topoisomerase I inhibitor, preventing religation of the DNA strand by binding to topoisomerase I-DNA complex.CAS:…
Product Name : Tedizolid phosphateDescription:Tedizolid phosphate (TR-701FA) is a novel oxazolidinone with activity against Gram-positive pathogens.CAS: 856867-55-5Molecular Weight:450.32Formula: C17H16FN6O6PChemical Name: {phenyl}-2-oxo-1,3-oxazolidin-5-yl]methoxy}phosphonic acidSmiles : CN1N=C(N=N1)C1=CC=C(C=N1)C1=CC=C(C=C1F)N1C(COP(O)(O)=O)OC1=OInChiKey: QCGUSIANLFXSGE-GFCCVEGCSA-NInChi : InChI=1S/C17H16FN6O6P/c1-23-21-16(20-22-23)15-5-2-10(7-19-15)13-4-3-11(6-14(13)18)24-8-12(30-17(24)25)9-29-31(26,27)28/h2-7,12H,8-9H2,1H3,(H2,26,27,28)/t12-/m1/s1Purity: ≥98% (or refer…
Product Name : H-D-cis-Hyp-OHDescription:cis-4-Hydroxy-D-proline is a precursor of conformationally restricted PNA adenine monomer. cis-4-Hydroxy-D-proline can be used to study the specificity and kinetics of D-alanine dehydrogenase.CAS: 2584-71-6Molecular Weight:131.13Formula: C5H9NO3Chemical Name:…
Product Name : MCC-DM1Description:MCC-DM1 is a drug-Linker Conjugates for ADC such ad Anti-CD22-MCC-DM1.CAS: 1100692-14-5Molecular Weight:974.55Formula: C47H64ClN5O13SChemical Name: (1S, 2R, 3S, 5S, 6S, 20R, 21S)-11-chloro-21-hydroxy-12, 20-dimethoxy-2, 5, 9, 16-tetramethyl-8, 23-dioxo-4, 24-dioxa-9,…
Product Name : cIAP1 Ligand-Linker Conjugates 9Description:cIAP1 Ligand-Linker Conjugates 9 incorporates an IAP ligand for the E3 ubiquitin ligase, and a PROTAC linker. cIAP1 Ligand-Linker Conjugates 9 can be used…
Product Name : MK2-IN-1Description:MK2-IN-1 is a potent and selecitve MAPKAPK2(MK2) inhibitor(IC50=0.11 uM) with a non-ATP competitive binding mode.IC50 value: 0.11 uM Target: MAPKAPK2(MK2) inhibitorMK2-IN-1 was profiled for kinase selectivity by…
Product Name : Salidroside(Rhodioloside)Description:Salidroside is a prolyl endopeptidase Inhibitor. Salidroside alleviates cachexia symptoms in mouse models of cancer cachexia via activating mTOR signalling. Salidroside protects dopaminergic neurons by enhancing PINK1/Parkin-mediated…
Product Name : MCU i4Description:MCU i4 is a negative modulator of mitochondrial calcium (Ca2+) uniporter (MCU) complex, which binds to MICU1, a regulatory protein within MCU complex. MCU i4 reduces…
Product Name : KO-947Description:KO-947 is a potent and selective inhibitor of ERK1/2 kinases. KO-947 blocks ERK signaling and proliferation of tumor cells exhibiting dysregulation of MAPK pathway signaling at low…
Product Name : AZD-2461Description:AZD2461 is a novel and potent PARP inhibitor with lower affinity to P-glycoprotein. AZD2641 is currently in Phase I clinical study. The study is being conducted to…
Product Name : 3'-O-MethylguanosineDescription:3'-O-Methylguanosine, also known as 3-OMG, is a methylated nucleoside analog and a RNA chain terminator. Early virus-specific RNA synthesis was preferentially inhibited by 3'-O-methyl guanosine.CAS: 10300-27-3Molecular Weight:297.27Formula:…
Product Name : NVP-ACC-789Description:ACC-789, also known as NVP-ACC789 and ZK-202650, is a potent, selective and orally active inhibitor of the VEGF receptor tyrosine kinases with potential anticancer activity.CAS: 300842-64-2Molecular Weight:405.29Formula:…
Product Name : GTS-21 2HClDescription:GTS-21 2HCl, also known as DMBX-A, is a derivative of the natural product anabaseine that acts as a partial agonist at neural nicotinic acetylcholine receptors. It…
Product Name : Daidzein-2c, Osteogenic ModulatorDescription:Daidzein-2c is a potent synthetic daidzein analog, has osteogenic induction potentials on human Mesenchymal Stem Cells (MSC). Human bone marrow derived mesenchymal stem cells from…
Product Name : Dehydroepiandrosterone sulfate-d6 sodium dihydrateDescription:Dehydroepiandrosterone sulfate-d6 (sodium dihydrate) is the deuterium labeled tert-Butyl N--2-phenylethyl]carbamate.CAS: Molecular Weight:432.54Formula: C19H31NaO7SChemical Name: Smiles : O.O.1(OS(=O)(=O)O)C()()C2(C)3CC4(C)(CCC4=O)3CC()=C2C1()InChiKey: NLNMKDUYGPNWAO-ATZAKXLYSA-MInChi : InChI=1S/C19H28O5S.Na.2H2O/c1-18-9-7-13(24-25(21,22)23)11-12(18)3-4-14-15-5-6-17(20)19(15,2)10-8-16(14)18;;;/h3,13-16H,4-11H2,1-2H3,(H,21,22,23);;2*1H2/q;+1;;/p-1/t13-,14-,15-,16-,18-,19-;;;/m0.../s1/i3D,7D2,11D2,13D;;;Purity: ≥98% (or refer to…
Product Name : VerbenoneDescription:Verbenone ((-)-Verbenone) is a natural terpene in leaves of the tree, Suregada zanzibariensis Verdc. Verbenone has anti-aggregation pheromone and interrupts the attraction of bark beetles to their…
Product Name : CEF1, Influenza Matrix Protein M1 (58-66)Description:CEF1, Influenza Matrix Protein M1 (58-66) is an epitope derived from the matrix protein of the influenza A virus.CAS: 141368-69-6Molecular Weight:966.17Formula: C49H75N9O11Chemical…
Product Name : (Rac)-Mirabegron D5Description:(Rac)-Mirabegron D5 ((Rac)-YM178 D5) is a deuterium labeled (Rac)-Mirabegron. (Rac)-Mirabegron is the racemate of Mirabegron. Mirabegron is a selective β3-adrenoceptor agonist.CAS: 1215807-38-7Molecular Weight:401.54Formula: C21H24N4O2SChemical Name: 2-(2-amino-1,3-thiazol-4-yl)-N-{4-ethyl}amino)ethyl]phenyl}acetamideSmiles…
Product Name : sFTX-3.3Description:sFTX-3.3 is a Ca2+ channel antagonist with IC50s of approximately 0.24 mM and 0.70 mM against P-type and N-type channels.CAS: 141997-14-0Molecular Weight:287.40Formula: C12H29N7OChemical Name: (2S)-2-amino-N-{3-propyl}-5-pentanamideSmiles : NC(N)=NCCC(N)C(=O)NCCCNCCCNInChiKey:…
Product Name : PF-03463275Description:PF-03463275 is a centrally penetrant, orally available, selective, and competitive GlyT1 (glycine transporter-1) reversible inhibitor, with a Ki of 11.6 nM. PF-03463275 has the potential for Schizophrenia…
Product Name : CX-6258 hydrochlorideDescription:CX-6258 hydrochloride is a potent and kinase selective pan-Pim kinases inhibitor, with IC50s of 5 nM, 25 nM and 16 nM for Pim-1, Pim-2 and Pim-3,…
Product Name : ProtogracillinDescription:Protogracillin is a steroidal saponin isolated from Dioscorea zingiberensis Wright (DZW). Steroidal saponins from DZW rhizomes have the potential to reduce the risk of cardiovascular diseases by…
Product Name : ChlorobenzuronDescription:Chlorobenzuron is a chitin synthetase inhibitor, acts as an insecticide. Chlorobenzuron can inhibit larvae development and pupate.CAS: 57160-47-1Molecular Weight:309.15Formula: C14H10Cl2N2O2Chemical Name: 1-(2-chlorobenzoyl)-3-(4-chlorophenyl)ureaSmiles : O=C(NC1C=CC(Cl)=CC=1)NC(=O)C1=CC=CC=C1ClInChiKey: YPSCQJTUAKNUNF-UHFFFAOYSA-NInChi : InChI=1S/C14H10Cl2N2O2/c15-9-5-7-10(8-6-9)17-14(20)18-13(19)11-3-1-2-4-12(11)16/h1-8H,(H2,17,18,19,20)Purity:…
Product Name : Macropa-NH2 hydrochlorideDescription:Macropa-NH2 hydrochloride is the precursor of Macropa-NCS. Macropa-NCS is conjugated to Anti-Human HER2 (HY-P9907) as well as to the prostate-specific membrane antigen-targeting compound RPS-070 and is…
Product Name : Propargyl-C8-amido-PEG2-NHS esterDescription:Propargyl-C8-amido-PEG2-NHS ester is a non-cleavable 2 unit PEG ADC linker used in the synthesis of antibody-drug conjugates (ADCs).CAS: 1006592-59-1Molecular Weight:438.51Formula: C22H34N2O7Chemical Name: 2,5-dioxopyrrolidin-1-yl 3-{2-ethoxy}propanoateSmiles : C#CCCCCCCCCC(=O)NCCOCCOCCC(=O)ON1C(=O)CCC1=OInChiKey:…
Product Name : t-Butyl acetate-PEG3-CH2COOHDescription:t-Butyl acetate-PEG3-CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 1442466-57-0Molecular Weight:322.35Formula: C14H26O8Chemical Name: 14-(tert-butoxy)-14-oxo-3,6,9,12-tetraoxatetradecanoic acidSmiles : CC(C)(C)OC(=O)COCCOCCOCCOCC(O)=OInChiKey: AIRJXXFDTSVEAV-UHFFFAOYSA-NInChi :…
Product Name : Norfluoxetine-d5Description:Product informationCAS: 1185132-92-6Molecular Weight:336.79Formula: C16H17ClF3NOChemical Name: 3-phenyl-3-(²H₅)propan-1-amine hydrochlorideSmiles : Cl.C(OC1C=CC(=CC=1)C(F)(F)F)(C1C=CC=CC=1)C()()C()()NInChiKey: GMTWWEPBGGXBTO-KDPCSTGBSA-NInChi : InChI=1S/C16H16F3NO.ClH/c17-16(18,19)13-6-8-14(9-7-13)21-15(10-11-20)12-4-2-1-3-5-12;/h1-9,15H,10-11,20H2;1H/i10D2,11D2,15D;Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as…
Product Name : ShanzisideDescription:Shanziside is a iridoid glucoside isolated from Phlomis tuberosa L.CAS: 29836-27-9Molecular Weight:392.36Formula: C16H24O11Chemical Name: (1S,4aS,5R,7S,7aS)-5,7-dihydroxy-7-methyl-1-{oxy}-1H,4aH,5H,6H,7H,7aH-cyclopentapyran-4-carboxylic acidSmiles : C1(O)C(O)21(OC=C2C(O)=O)O1O(CO)(O)(O)1OInChiKey: YSIFYNVXJOGADM-KDYWOABDSA-NInChi : InChI=1S/C16H24O11/c1-16(24)2-6(18)8-5(13(22)23)4-25-14(9(8)16)27-15-12(21)11(20)10(19)7(3-17)26-15/h4,6-12,14-15,17-21,24H,2-3H2,1H3,(H,22,23)/t6-,7-,8+,9-,10-,11+,12-,14+,15+,16+/m1/s1Purity: ≥98% (or refer to the Certificate…
Product Name : Apalutamide-COOHDescription:Apalutamide-COOH can be used to synthesis Apalutamide. Apalutamide is a potent and competitive androgen receptor (AR) antagonist, binding AR with an IC50 of 16 nM.CAS: 1332391-04-4Molecular Weight:464.39Formula:…
Product Name : Mal-PEG4-VADescription:Mal-PEG4-VA is a cleavable ADC linker containing a Maleimide group. Mal-PEG4-VA is used for making antibody-drug conjugate.CAS: 1800456-31-8Molecular Weight:586.63Formula: C26H42N4O11Chemical Name: (2S)-2--3,6,9,12-tetraoxapentadecan-15-amido}-3-methylbutanamido]propanoic acidSmiles : CC(C)(NC(=O)CCOCCOCCOCCOCCNC(=O)CCN1C(=O)C=CC1=O)C(=O)N(C)C(O)=OInChiKey: JQKQDAYKTXEJOZ-CYFREDJKSA-NInChi :…
Product Name : Transdermal Peptide DisulfideDescription:Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa+/K+-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide…
Product Name : BL-918Description:BL-918 is an orally active UNC-51-like kinase 1 (ULK1) activator with an EC50 of 24.14 nM. BL-918 exerts its cytoprotective autophagic effect by targeting ULK complex. BL-918…
Product Name : FMKDescription:Fmk is an irreversible ribosomal S6 kinase inhibitor 1/2 inhibitor.CAS: 821794-92-7Molecular Weight:342.37Formula: C18H19FN4O2Chemical Name: 1-pyrimidin-6-yl]-2-fluoroethan-1-oneSmiles : CC1C=CC(=CC=1)C1C2=C(N)N=CN=C2N(CCCO)C=1C(=O)CFInChiKey: IKLGYJACVCXYIL-UHFFFAOYSA-NInChi : InChI=1S/C18H19FN4O2/c1-11-3-5-12(6-4-11)14-15-17(20)21-10-22-18(15)23(7-2-8-24)16(14)13(25)9-19/h3-6,10,24H,2,7-9H2,1H3,(H2,20,21,22)Purity: ≥98% (or refer to the Certificate of…
Product Name : Valproic acidDescription:AI-10-49 is an inhibitor that binds the transcription factor fusion CBFβ-SMMHC. AI-10-49, that selectively binds to CBFβ-SMMHC and disrupts its binding to RUNX1. AI-10-49 restores RUNX1…
Product Name : β-Amyloid (1-40)Description:β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.CAS: 131438-79-4Molecular Weight:4329.80Formula: C194H295N53O58SChemical Name: (4S)-5-amino]-3-methyl-1-oxobutan-2-yl]amino]-2-oxoethyl]amino]-2-oxoethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-1-oxohexan-2-yl]amino]-1, 4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1, 5-dioxopentan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-amino]propanoyl]amino]-5-oxopentanoic acidSmiles :…
Product Name : LY451395Description:Mibampator, also known as LY-451395, is an AMPA receptor potentiator under development for agitation/aggression in Alzheimer's disease. Patients treated with LY451395 did not show a statistically significant…
Product Name : FomesafenDescription:Fomesafen is a type of efficient and selective protoporphyrinogen IX oxidase (PPO) inhibitor. Fomesafen is a herbicide and has the advantages of low toxicity and high selectivity.CAS:…
Product Name : Moracin MDescription:Moracin M, a phenolic component in the skin of Morus alba L., is a potent phosphodiesterase-4 (PDE4) inhibitor with IC50 values of 2.9, 4.5, >40, and…
Product Name : PH-002Description:PH-002 is an inhibitor of apolipoprotein (apo) E4 intramolecular domain interaction in neuronal cells that could rescue impairments of mitochondrial motility and neurite outgrowth.CAS: 1311174-68-1Molecular Weight:491.58Formula: C27H33N5O4Chemical…
Product Name : NL-1Description:NL-1 is a mitoNEET inhibitor with antileukemic effect. NL-1 inhibits REH and REH/Ara-C cells growth with IC50s of 47.35 µM and 56.26 µM, respectively. NL-1-mediated death in…
Product Name : 5-Fluorouridine 5'-O-β-D-galactopyranosideDescription:5-Fluorouridine 5'-O-β-D-galactopyranoside (5'-O-β-D-galactosyl-5-fluorouridine) is a 5-Fluorouridine prodrug. 5-Fluorouridine 5'-O-β-D-galactopyranoside can be converted by the enzyme β-D-galactosidase to the potent antineoplastic agent 5-Fluorouridine.CAS: 149965-92-4Molecular Weight:424.33Formula: C15H21FN2O11Chemical Name:…
Product Name : Thiol-C9-PEG5Description:Thiol-C9-PEG5 is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 130727-42-3Molecular Weight:380.58Formula: C19H40O5SChemical Name: 23-sulfanyl-3,6,9,12-tetraoxatricosan-1-olSmiles : OCCOCCOCCOCCOCCCCCCCCCCCSInChiKey: IOBMVUDHPRVCSO-UHFFFAOYSA-NInChi : InChI=1S/C19H40O5S/c20-10-12-22-14-16-24-18-17-23-15-13-21-11-8-6-4-2-1-3-5-7-9-19-25/h20,25H,1-19H2Purity: ≥98% (or…
Product Name : TRO 19622Description:Olesoxime, also known as TRO-19622 and RG6083, is an experimental neuroprotective drug. Olesoxime has a cholesterol-like structure and displays neuroprotective properties. Preclinical studies have demonstrated that…
Product Name : CadrofloxacinDescription:Cadrofloxacin, also known as Caderofloxacin and CS-940, is a novel fluoroquinolone antibacterial. The activities of CS-940 against gram-positive cocci and gram-negative rods, including methicillin-susceptible Staphylococcus aureus and…
Product Name : (R,R)-CFT8634Description:(R, R)-CFT8634 is a selective and orally active BRD9 protein degrader. (R, R)-CFT8634 has the potential for the research of disorders mediated by BRD9, including but not…
Product Name : Lp-PLA2-IN-2Description:Lp-PLA2-IN-2 is a potent and selective lipoprotein-associated phospholipase A2 (Lp-PLA2) inhibitor, with an IC50 0f 120 nM for recombinant human Lp-PLA2.CAS: 2071636-15-0Molecular Weight:394.46Formula: C19H23FN2O4SChemical Name: 2-fluoro-5-{2-ethoxy}benzonitrileSmiles :…
Product Name : VU0810464Description:VU0810464 is a potent and selective non-ureaG protein-gated inwardly-rectifying potassium channels (GIRK, Kir3) activator. VU0810464 displays nanomolar potency for neuronal (EC50=165 nM) and GIRK1/4 (EC50=720 nM) channels…
Product Name : AcoramidisDescription:Acoramidis (AG10) is an orally active and selective kinetic stabilizer of WT and V122I-TTR (transthyretin). Acoramidis (AG10) is used in the study for transthyretin amyloidosis.CAS: 1446711-81-4Molecular Weight:292.31Formula:…
Product Name : ZL0580Description:ZL0580, a structurally close analog of ZL0590, induces epigenetic suppression of HIV via selectively binding to BD1 domain of BRD4. ZL0580 induces HIV suppression by inhibiting Tat…
Product Name : PD 404182Description:PD 404182 is a potent and competitive inhibitor of human dimethylarginine dimethylaminohydrolase 1 (DDAH1), with an IC50 of 9 μM. PD 404182 exhibits antiangiogenic and antiviral…
Product Name : Azido-PEG2-CH2COOHDescription:Azido-PEG2-CH2COOH is a PEG-based PROTAC linker can be used in the synthesis of PROTACs.CAS: 882518-90-3Molecular Weight:189.17Formula: C6H11N3O4Chemical Name: 2-acetic acidSmiles : ==NCCOCCOCC(O)=OInChiKey: OCIIYNXOTJRSHW-UHFFFAOYSA-NInChi : InChI=1S/C6H11N3O4/c7-9-8-1-2-12-3-4-13-5-6(10)11/h1-5H2,(H,10,11)Purity: ≥98% (or…
Product Name : Tri-(PEG1-C2-acid)Description:Tri-(PEG1-C2-acid) is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 1381861-95-5Molecular Weight:365.38Formula: C15H27NO9Chemical Name: 3-(2-{bisamino}ethoxy)propanoic acidSmiles : OC(=O)CCOCCN(CCOCCC(O)=O)CCOCCC(O)=OInChiKey: QNHMUDRSUKYNFE-UHFFFAOYSA-NInChi : InChI=1S/C15H27NO9/c17-13(18)1-7-23-10-4-16(5-11-24-8-2-14(19)20)6-12-25-9-3-15(21)22/h1-12H2,(H,17,18)(H,19,20)(H,21,22)Purity: ≥98%…
Product Name : MS4077Description:MS4077 is an anaplastic lymphoma kinase (ALK) PROTAC (degrader) with a Kd of 37 nM for binding affinity to ALK.CAS: 2230077-10-6Molecular Weight:1134.73Formula: C55H72ClN9O13SChemical Name: 2-(4-{4-amino}pyrimidin-2-yl)amino]-2-methyl-5-(propan-2-yloxy)phenyl}piperidin-1-yl)-N-(17-{amino}-3,6,9,12,15-pentaoxaheptadecan-1-yl)acetamideSmiles : CC1=CC(NC2=NC(NC3=CC=CC=C3S(=O)(=O)C(C)C)=C(Cl)C=N2)=C(C=C1C1CCN(CC(=O)NCCOCCOCCOCCOCCOCCNC2=CC=CC3=C2C(=O)N(C2CCC(=O)NC2=O)C3=O)CC1)OC(C)CInChiKey: VEKJQNCZEPLNJF-UHFFFAOYSA-NInChi…
Product Name : Nisoldipine-d4Description:Nisoldipine-d4 (BAY-k 5552-d4) is the deuterium labeled Nisoldipine. Nisoldipine(BAY-k 5552) is a calcium channel blocker belonging to the dihydropyridines class, specific for L-type Cav1.2 with IC50 of…
Product Name : TerbufibrolDescription:Terbufibrol has been shown highly active in reducing serum total cholesterol (TC) levels in the normal and hypercholesterolemic male rat.CAS: 56488-59-6Molecular Weight:344.40Formula: C20H24O5Chemical Name: 4-benzoic acidSmiles :…
Product Name : Tenacissoside GDescription:Tenacissoside G is a C21 steroid from the stems of Marsdenia tenacissima. Tenacissoside G reverses multidrug resistance in P-glycoprotein (Pgp)-overexpressing multidrug-resistant cancer cells.CAS: 191729-43-8Molecular Weight:792.95Formula: C42H64O14Chemical…
Product Name : TrifludimoxazinDescription:Trifludimoxazin is a protoporphyrinogen oxidase inhibiting (PPO) herbicide.CAS: 1258836-72-4Molecular Weight:412.34Formula: C16H11F3N4O4SChemical Name: 1,5-dimethyl-6-sulfanylidene-3--1,3,5-triazinane-2,4-dioneSmiles : CN1C(=S)N(C)C(=O)N(C2=CC3=C(C=C2F)OC(F)(F)C(=O)N3CC#C)C1=OInChiKey: AZHZOGYUMMIAOF-UHFFFAOYSA-NInChi : InChI=1S/C16H11F3N4O4S/c1-4-5-22-10-7-9(8(17)6-11(10)27-16(18,19)12(22)24)23-13(25)20(2)15(28)21(3)14(23)26/h1,6-7H,5H2,2-3H3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition:…
Product Name : LithospermosideDescription:Lithospermoside (Griffonin) is a nature product isolated from the stem bark of Ochna schweinfurthiana F. Hoffm.CAS: 63492-69-3Molecular Weight:329.30Formula: C14H19NO8Chemical Name: 2-oxy}cyclohex-2-en-1-ylidene]acetonitrileSmiles : N#C/C=C1/C=C(O)(O)/1O1O(CO)(O)(O)1OInChiKey: WIIDBJNWXCWLKF-VVAXPEBGSA-NInChi : InChI=1S/C14H19NO8/c15-4-3-6-1-2-7(17)9(18)13(6)23-14-12(21)11(20)10(19)8(5-16)22-14/h1-3,7-14,16-21H,5H2/b6-3-/t7-,8-,9+,10-,11+,12-,13+,14+/m1/s1Purity: ≥98%…
Product Name : S-8921Description:S-8921 is an ileal Na+/bile acid cotransporter (IBAT) inhibitor.CAS: 151165-96-7Molecular Weight:540.60Formula: C30H36O9Chemical Name: methyl 1-(3,4-dimethoxyphenyl)-3-(3-ethylpentanoyl)-4-hydroxy-6,7,8-trimethoxynaphthalene-2-carboxylateSmiles : COC(=O)C1=C(C2=C(OC)C(OC)=C(C=C2C(O)=C1C(=O)CC(CC)CC)OC)C1=CC(OC)=C(C=C1)OCInChiKey: QEJQEIIPZKQCNP-UHFFFAOYSA-NInChi : InChI=1S/C30H36O9/c1-9-16(10-2)13-19(31)25-26(30(33)39-8)23(17-11-12-20(34-3)21(14-17)35-4)24-18(27(25)32)15-22(36-5)28(37-6)29(24)38-7/h11-12,14-16,32H,9-10,13H2,1-8H3Purity: ≥98% (or refer to the Certificate of…
Product Name : EnpatoranDescription:Enpatoran (M5049) is a potent, orally active and dual TLR7/8 inhibitor with IC50s of 11.1 nM and 24.1 nM in HEK293 cells, respectively. Enpatoran is inactive against…
Product Name : ALD-PEG4-OPFPDescription:ALD-PEG4-OPFP is a cleavable 4 unit PEG ADC linker used in the synthesis of antibody-drug conjugates (ADCs).CAS: 1324007-10-4Molecular Weight:563.47Formula: C25H26F5NO8Chemical Name: 2,3,4,5,6-pentafluorophenyl 1--3,6,9,12-tetraoxapentadecan-15-oateSmiles : O=CC1C=CC(=CC=1)C(=O)NCCOCCOCCOCCOCCC(=O)OC1C(F)=C(F)C(F)=C(F)C=1FInChiKey: NHBPGMASABKYSZ-UHFFFAOYSA-NInChi :…
Product Name : 5-Acetyl-d3-amino-6-formylamino-3-methyluracilDescription:Product informationCAS: 1185082-65-8Molecular Weight:229.21Formula: C8H10N4O4Chemical Name: N-(6-formamido-3-methyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)(²H₃)acetamideSmiles : C()()C(=O)NC1=C(NC=O)NC(=O)N(C)C1=OInChiKey: RDZNZFGKEVDNPK-FIBGUPNXSA-NInChi : InChI=1S/C8H10N4O4/c1-4(14)10-5-6(9-3-13)11-8(16)12(2)7(5)15/h3H,1-2H3,(H,9,13)(H,10,14)(H,11,16)/i1D3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as non-hazardous…
Product Name : Acid-PEG4-mono-methyl esterDescription:Acid-PEG4-mono-methyl ester is a PEG- and Alkyl/ether-based PROTAC linker can be used in the synthesis of PROTACs.CAS: 2028284-75-3Molecular Weight:308.32Formula: C13H24O8Chemical Name: 16-methoxy-16-oxo-4,7,10,13-tetraoxahexadecanoic acidSmiles : COC(=O)CCOCCOCCOCCOCCC(O)=OInChiKey: MOGNNSWXCSXEEM-UHFFFAOYSA-NInChi…
Product Name : 2-Amino-5-phenylpyridineDescription:2-Amino-5-phenylpyridine is a mutagenic heterocyclic aromatic amine that is formed by pyrolysis of phenylalanine in proteins. 2-Amino-5-phenylpyridine is in broiled sardines and is considered as potentially carcinogenic.CAS:…
Product Name : ML-211Description:IC50: LYPLA1 (17 nM) and the related LYPLA2 (30 nM) ML-211 is a dual inhibitor of LYPLA1 and the related LYPLA2. Lysophospholipase 1 (LYPLA1), a protein palmitoyl…
Product Name : NBOH-2C-CN hydrochlorideDescription:Product informationCAS: 1539266-32-4Molecular Weight:348.82Formula: C18H21ClN2O3Chemical Name: 4-(2-{amino}ethyl)-2,5-dimethoxybenzonitrile hydrochlorideSmiles : Cl.COC1=CC(C#N)=C(C=C1CCNCC1=CC=CC=C1O)OCInChiKey: JQVAEIIIMVMJBO-UHFFFAOYSA-NInChi : InChI=1S/C18H20N2O3.ClH/c1-22-17-10-15(11-19)18(23-2)9-13(17)7-8-20-12-14-5-3-4-6-16(14)21;/h3-6,9-10,20-21H,7-8,12H2,1-2H3;1HPurity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
Product Name : ZAPA sulfateDescription:Product informationCAS: 371962-01-5Molecular Weight:244.25Formula: C4H8N2O6S2Chemical Name: (2Z)-3-(carbamimidoylsulfanyl)prop-2-enoic acid; sulfuric acidSmiles : NC(=N)S/C=C\C(O)=O.OS(O)(=O)=OInChiKey: UWVNHPNVOMFDHW-ODZAUARKSA-NInChi : InChI=1S/C4H6N2O2S.H2O4S/c5-4(6)9-2-1-3(7)8;1-5(2,3)4/h1-2H,(H3,5,6)(H,7,8);(H2,1,2,3,4)/b2-1-;Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under…
Product Name : (±)-AC 7954 hydrochlorideDescription:Product informationCAS: 477313-09-0Molecular Weight:366.28Formula: C19H21Cl2NO2Chemical Name: (3R)-3-(4-chlorophenyl)-3--3,4-dihydro-1H-2-benzopyran-1-one hydrochlorideSmiles : Cl.CN(C)CC1(CC2=CC=CC=C2C(=O)O1)C1C=CC(Cl)=CC=1InChiKey: AJPGLOWFIBOGMH-FYZYNONXSA-NInChi : InChI=1S/C19H20ClNO2.ClH/c1-21(2)12-11-19(15-7-9-16(20)10-8-15)13-14-5-3-4-6-17(14)18(22)23-19;/h3-10H,11-13H2,1-2H3;1H/t19-;/m0./s1Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient…
Product Name : Bay 36-7620Description:Metabotropic glutamate (mGlu) receptors are G proteincoupled receptors (GPCRs) that act predominantly as modulators of synaptic transmission. As such, they play a role in many physiological…
Product Name : p-Toluenesulfonic acid sodium salt, 90+%Synonym: IUPAC Name : sodium 4-methylbenzene-1-sulfonateCAS NO.:657-84-1Molecular Weight : Molecular formula: C7H7NaO3SSmiles: .Clavulanate potassium CC1=CC=C(C=C1)S()(=O)=ODescription: Ponatinib PMID:24856309
Product Name : Fumonisin B1, 96%Synonym: IUPAC Name : (2S)-2-(2-{oxy}-11,16,18-trihydroxy-5,9-dimethylicosan-7-yl]oxy}-2-oxoethyl)butanedioic acidCAS NO.:116355-83-0Molecular Weight : Molecular formula: C34H59NO15Smiles: CCCC(C)(OC(=O)C(CC(O)=O)C(O)=O)(C(C)C(O)CCCC(O)C(O)(C)N)OC(=O)C(CC(O)=O)C(O)=ODescription: Schisandrin RI-1 PMID:26446225
Product Name : Cinnamyl alcohol, 98%Synonym: IUPAC Name : (2Z)-3-phenylprop-2-en-1-olCAS NO.Nitro blue tetrazolium chloride :104-54-1Molecular Weight : Molecular formula: C9H10OSmiles: OCC=C/C1=CC=CC=C1Description: Cinnamyl alcohol is an important raw material and intermediate…
Product Name : 4-Chlororesorcinol, 98%Synonym: IUPAC Name : CAS NO.:95-88-5Molecular Weight : Molecular formula: Smiles: Description: Andecaliximab Ceftobiprole PMID:23509865
Product Name : N-(Benzyloxycarbonyloxy)succinimide, 98%Synonym: IUPAC Name : benzyl 2,5-dioxopyrrolidin-1-yl carbonateCAS NO.:13139-17-8Molecular Weight : Molecular formula: C12H11NO5Smiles: O=C(OCC1=CC=CC=C1)ON1C(=O)CCC1=ODescription: Lapatinib ditosylate Cimetidine PMID:35126464 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : Tetra-n-butylammonium perchlorate, electrochemical gradeSynonym: IUPAC Name : tetrabutylazanium perchlorateCAS NO.Etanercept :1923-70-2Molecular Weight : Molecular formula: C16H36ClNO4Smiles: (=O)(=O)=O.K67 CCCC(CCCC)(CCCC)CCCCDescription: Suitable for use as a polarographic supporting electrolyteTetra-n-butylammonium perchlorate…
Product Name : 4-Cyanobenzyl alcohol, 97%Synonym: IUPAC Name : CAS NO.Avapritinib :Molecular Weight : Molecular formula: Smiles: Description: 4-Cyanobenzyl alcohol is used as pharmaceutical intermediate.Chloroquine phosphate PMID:25818744 MedChemExpress (MCE) offers…
Product Name : Starch, soluble, ACS (for iodometry)Synonym: IUPAC Name : (2R,3S,4S,5R,6R)-2-(hydroxymethyl)-6-{oxy}oxane-3,4,5-triolCAS NO.:9005-84-9Molecular Weight : Molecular formula: C12H22O11Smiles: OC1O(O2(O)(O)(O)O2CO)(O)(O)1ODescription: In food industry, starch is used as a food preservative.Zonisamide Starch…
Product Name : Trimethylamine hydrochloride, 98%Synonym: IUPAC Name : hydrogen trimethylamine chlorideCAS NO.:593-81-7Molecular Weight : Molecular formula: C3H10ClNSmiles: ..CN(C)CDescription: Trimethylamine hydrochloride is used in the manufacture of quaternary ammonium compounds,…
Product Name : 4-(Trifluoromethyl)phenyl isothiocyanate, 98+%Synonym: IUPAC Name : 1-isothiocyanato-4-(trifluoromethyl)benzeneCAS NO.Ofloxacin :1645-65-4Molecular Weight : Molecular formula: C8H4F3NSSmiles: FC(F)(F)C1=CC=C(C=C1)N=C=SDescription: Rogaratinib PMID:23546012
Product Name : Mercury(II) bromide, 99+%Synonym: IUPAC Name : mercury(2+) dibromideCAS NO.DTT :7789-47-1Molecular Weight : Molecular formula: Br2HgSmiles: .Saroglitazar .PMID:23715856 Description:
Product Name : Cobalt(II) chloride, 97%, anhydrousSynonym: IUPAC Name : λ²-cobalt(2+) dichlorideCAS NO.:7646-79-9Molecular Weight : Molecular formula: Cl2CoSmiles: ..Description: This Thermo Scientific Chemicals brand product was originally part of the…
Product Name : Sodium fluoride, Optical GradeSynonym: IUPAC Name : sodium fluorideCAS NO.:7681-49-4Molecular Weight : Molecular formula: FNaSmiles: .Nintedanib Description: It has medical and other applications including complexing of magnesium…
Product Name : Triethyl 2-phosphonopropionate, 98%Synonym: IUPAC Name : ethyl 2-(diethoxyphosphoryl)propanoateCAS NO.Asiatic acid :3699-66-9Molecular Weight : Molecular formula: C9H19O5PSmiles: CCOC(=O)C(C)P(=O)(OCC)OCCDescription: Pioglitazone hydrochloride PMID:25040798 MedChemExpress (MCE) offers a wide range of…
Product Name : Sulfur in Heavy Mineral Oil standard solution, Specpure™, 10μg/g (0.0010%)Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Paltusotine Tideglusib PMID:24578169
Product Name : Manganese(II) bromide, 99%, anhydrousSynonym: IUPAC Name : manganese(2+) dibromideCAS NO.Aflibercept :13446-03-2Molecular Weight : Molecular formula: Br2MnSmiles: .Clofibrate .PMID:23310954 Description:
Product Name : 3-Ethoxy-5-(trifluoromethyl)benzeneboronic acid, 98%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Reactant involved in suzuki-miyaura cross-coupling reactions, aerobic oxidative cross-coupling, rhodium-catalyzed addition reactions.Fuzapladib (sodium)…
Product Name : Tolazoline hydrochloride, 99%Synonym: IUPAC Name : hydrogen 2-benzyl-4,5-dihydro-1H-imidazole chlorideCAS NO.Mirvetuximab soravtansine (solution) :59-97-2Molecular Weight : Molecular formula: C10H13ClN2Smiles: .Tacrolimus .PMID:23613863 C(C1=NCCN1)C1=CC=CC=C1Description:
Product Name : trans-4-(Benzyloxycarbonylamino)cyclohexylamine, 97%Synonym: IUPAC Name : CAS NO.Cedazuridine :Molecular Weight : Molecular formula: Smiles: Description: trans-4-(Benzyloxycarbonylamino)cyclohexylamine is used as pharmaceutical intermediate.Tigecycline PMID:24182988 MedChemExpress (MCE) offers a wide range…
Product Name : Sodium hexafluorosilicate, >99%Synonym: IUPAC Name : disodium hexafluorosilanediuideCAS NO.:16893-85-9Molecular Weight : Molecular formula: F6Na2SiSmiles: ..F(F)(F)(F)(F)FDescription: Sodium hexafluorosilicate is used as a additive for water fluoridation, opal glass…
Product Name : 1,3-Dibromo-2-chloro-5-fluorobenzene, 98%Synonym: IUPAC Name : CAS NO.:179897-90-6Molecular Weight : Molecular formula: Smiles: Description: Denosumab JS25 PMID:23381626
Product Name : 2,5-Dimethoxytetrahydrofuran, cis + trans, 98%Synonym: IUPAC Name : 2,5-dimethoxyoxolaneCAS NO.:696-59-3Molecular Weight : Molecular formula: C6H12O3Smiles: COC1CCC(OC)O1Description: 2,5-Dimethoxytetrahydrofuran is a tetrahydrofuran derivative that finds application in proteomics research…
Product Name : n-Butyl phosphate, mixture of mono-n-butyl and di-n-butylSynonym: IUPAC Name : butoxyphosphonic acid; dibutoxyphosphinic acidCAS NO.:52933-01-4Molecular Weight : Molecular formula: C12H30O8P2Smiles: CCCCOP(O)(O)=O.Trilaciclib CCCCOP(O)(=O)OCCCCDescription: n-Butyl phosphate is a solvent…
Product Name : Methyl 2,2-dimethylacetoacetate, 99%Synonym: IUPAC Name : methyl 2,2-dimethyl-3-oxobutanoateCAS NO.:38923-57-8Molecular Weight : Molecular formula: C7H12O3Smiles: COC(=O)C(C)(C)C(C)=ODescription: Pyrimidine was synthesis from methyl 2, 2-dimethylacetoacetate.Elexacaftor Atropine PMID:23563799
Product Name : Lithium bromide, ultra dry, 99.998% (metals basis)Synonym: IUPAC Name : lithium(1+) bromideCAS NO.Linperlisib :7550-35-8Molecular Weight : Molecular formula: BrLiSmiles: .Sonelokimab Description: Employed as adsorbents, functional fluids (closed…
Product Name : Aluminum oxide, super activated, neutral, Grade ISynonym: IUPAC Name : dialuminium(3+) trioxidandiideCAS NO.:1344-28-1Molecular Weight : Molecular formula: Al2O3Smiles: ....Description: Aluminum oxide is used as an adsorbent, desiccating…
Product Name : 2-Bromopropionyl chloride, 98%Synonym: IUPAC Name : 2-bromopropanoyl chlorideCAS NO.Flucytosine :7148-74-5Molecular Weight : Molecular formula: C3H4BrClOSmiles: CC(Br)C(Cl)=ODescription: Auranofin PMID:25269910
Product Name : 5-Fluoro-1,3-dimethyl-2-nitrobenzene, 98%Synonym: IUPAC Name : 5-fluoro-1,3-dimethyl-2-nitrobenzeneCAS NO.Decitabine :315-12-8Molecular Weight : Molecular formula: C8H8FNO2Smiles: CC1=CC(F)=CC(C)=C1()=ODescription: Tepotinib PMID:34856019
Product Name : 3-chlorobenzenesulfonyl chloride, 98%Synonym: IUPAC Name : 3-chlorobenzene-1-sulfonyl chlorideCAS NO.:2888-06-4Molecular Weight : Molecular formula: C6H4Cl2O2SSmiles: ClC1=CC=CC(=C1)S(Cl)(=O)=ODescription: Clioquinol Conivaptan hydrochloride PMID:23776646
Product Name : Phenyl trans-beta-styryl sulfone, 96%Synonym: IUPAC Name : benzeneCAS NO.:16212-06-9Molecular Weight : Molecular formula: C14H12O2SSmiles: O=S(=O)(C=C/C1=CC=CC=C1)C1=CC=CC=C1Description: Phenyl trans-beta-styryl sulfone is used as a building block for proteomics research.Atovaquone…
Product Name : Silver(I) oxide, 99+%Synonym: IUPAC Name : (argentiooxy)silverCAS NO.:20667-12-3Molecular Weight : Molecular formula: Ag2OSmiles: ODescription: Polatuzumab vedotin Bimekizumab PMID:35991869 MedChemExpress (MCE) offers a wide range of high-quality research…
Product Name : Triphosgene, 98%Synonym: IUPAC Name : ditrichloromethyl carbonateCAS NO.:32315-10-9Molecular Weight : Molecular formula: C3Cl6O3Smiles: ClC(Cl)(Cl)OC(=O)OC(Cl)(Cl)ClDescription: Triphosgene is used as a carbonylating agent for aza-peptide synthesis.Olodaterol It reacts with…
Product Name : Propargyl bromide, 80 wt.% solution in toluene, stabilizedSynonym: IUPAC Name : CAS NO.:106-96-7Molecular Weight : Molecular formula: Smiles: Description: Rucaparib Verapamil PMID:23329650
Product Name : 4-Iodobenzyl alcohol, 97%Synonym: IUPAC Name : (4-iodophenyl)methanolCAS NO.:18282-51-4Molecular Weight : Molecular formula: C7H7IOSmiles: OCC1=CC=C(I)C=C1Description: Mycophenolic acid Maslinic acid PMID:25105126
Product Name : Niobium wire, 1.0mm (0.04in) dia, 99.8% (metals basis)Synonym: IUPAC Name : niobiumCAS NO.7α-Hydroxycholesterol :7440-03-1Molecular Weight : Molecular formula: NbSmiles: Description: Azilsartan medoxomil PMID:23746961
Product Name : Methyl 3-aminobenzoate, 98%Synonym: IUPAC Name : methyl 3-aminobenzoateCAS NO.:4518-10-9Molecular Weight : Molecular formula: C8H9NO2Smiles: COC(=O)C1=CC=CC(N)=C1Description: Methyl 3-aminobenzoate, is an important raw material and intermediate used in organic…
Product Name : 2-Hexanone, 98%Synonym: IUPAC Name : hexan-2-oneCAS NO.:591-78-6Molecular Weight : Molecular formula: C6H12OSmiles: CCCCC(C)=ODescription: Anagliptin Verapamil PMID:24518703 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : Lanthanum(III) chloride, ultra dry, 99.9% (REO)Synonym: IUPAC Name : lanthanum(3+) trichlorideCAS NO.:10099-58-8Molecular Weight : Molecular formula: Cl3LaSmiles: ...Description: Lanthanum chloride solutions are used in various water treatment…
Product Name : 3-Iodo-o-xylene, 97%Synonym: IUPAC Name : 1-iodo-2,3-dimethylbenzeneCAS NO.:31599-60-7Molecular Weight : Molecular formula: C8H9ISmiles: CC1=CC=CC(I)=C1CDescription: Nifedipine Evobrutinib PMID:35116795
Product Name : n-Decyltrimethoxysilane, 97%Synonym: IUPAC Name : CAS NO.:5575-48-4Molecular Weight : Molecular formula: Smiles: Description: n-Decyltrimethoxysilane is used as a coupling agent and as a pharmaceutical intermediate.Fostamatinib Teriparatide PMID:24487575
Product Name : 4-Hydroxy-4-methyl-2-pentanone, 99%Synonym: IUPAC Name : 4-hydroxy-4-methylpentan-2-oneCAS NO.Estetrol :123-42-2Molecular Weight : Molecular formula: C6H12O2Smiles: CC(=O)CC(C)(C)ODescription: Zoledronic Acid PMID:27217159
Product Name : 4-Isopropylphenol, 98%Synonym: IUPAC Name : 4-(propan-2-yl)phenolCAS NO.:99-89-8Molecular Weight : Molecular formula: C9H12OSmiles: CC(C)C1=CC=C(O)C=C1Description: Ampicillin sodium Secnidazole PMID:22664133
Product Name : Copper(II) chloride, 99%, extra pure, anhydrousSynonym: IUPAC Name : copper(2+) dichlorideCAS NO.:7447-39-4Molecular Weight : Molecular formula: Cl2CuSmiles: .Temsirolimus .Abrocitinib Description: PMID:24189672 MedChemExpress (MCE) offers a wide range…
Product Name : 2-Ethyl-3,5(6)-dimethylpyrazine, 99%, mixture of isomersSynonym: IUPAC Name : 2-ethyl-3,5-dimethylpyrazineCAS NO.:13925-07-0Molecular Weight : Molecular formula: C8H12N2Smiles: CCC1=NC=C(C)N=C1CDescription: It is applied as an odorant of coffee brews, nutty flavor…
Product Name : Acenaphthene, 99%Synonym: IUPAC Name : 1,2-dihydroacenaphthyleneCAS NO.:83-32-9Molecular Weight : Molecular formula: C12H10Smiles: C1CC2=C3C1=CC=CC3=CC=C2Description: Gosuranemab Secnidazole PMID:23600560
Product Name : 4,5-Dichloropyridazin-3(2H)-one, 98%Synonym: IUPAC Name : 4,5-dichloro-2,3-dihydropyridazin-3-oneCAS NO.Topiroxostat :932-22-9Molecular Weight : Molecular formula: C4H2Cl2N2OSmiles: ClC1=C(Cl)C(=O)NN=C1Description: MS170 PMID:23075432
Product Name : Non-wetting platinum 5% gold crucible, Top Dia 49mm, Bot Dia30mm, Ht 41mm, Base Thickness 0.36mm, Capacity 50mLSynonym: IUPAC Name : CAS NO.Epalrestat :Molecular Weight : Molecular formula:…
Product Name : Toluene, for HPLCSynonym: IUPAC Name : tolueneCAS NO.Anti-Mouse CD3 Antibody :108-88-3Molecular Weight : Molecular formula: C7H8Smiles: CC1=CC=CC=C1Description: Tanezumab PMID:23672196
Product Name : 2,4,6-Tribromo-3-hydroxybenzaldehyde, 98%Synonym: IUPAC Name : 2,4,6-tribromo-3-hydroxybenzaldehydeCAS NO.Streptomycin :2737-22-6Molecular Weight : Molecular formula: C7H3Br3O2Smiles: OC1=C(Br)C=C(Br)C(C=O)=C1BrDescription: Melittin PMID:35670838 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : 2-Mercaptoethanol, Electrophoresis Grade, 98+%Synonym: IUPAC Name : 2-sulfanylethan-1-olCAS NO.:60-24-2Molecular Weight : Molecular formula: C2H6OSSmiles: OCCSDescription: β-Mercaptoethanol can act as an enzyme reactivator in systems necessitating reduction for…
Product Name : Sodium cyclopentadienide, 2-3M in THFSynonym: IUPAC Name : sodium cyclopenta-2,4-dien-1-ideCAS NO.:4984-82-1Molecular Weight : Molecular formula: C5H5NaSmiles: .Edaravone 1C=CC=C1Description: Inolimomab PMID:27641997 MedChemExpress (MCE) offers a wide range of…
Product Name : 3,5-Difluorosalicylic acid, 98+%Synonym: IUPAC Name : 3,5-difluoro-2-hydroxybenzoic acidCAS NO.Rasburicase :84376-20-5Molecular Weight : Molecular formula: C7H4F2O3Smiles: OC(=O)C1=CC(F)=CC(F)=C1ODescription: Tebotelimab PMID:32261617
Product Name : Sepabeads|r SP850, synthetic adsorbent resin, highly porous type, PS-DVB, P.R. 45 angstromsSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Amino acid separations, small…
Product Name : 4,4,5,5-Tetramethyl-2-(1-methylpiperid-4-yl)-1,3,2-dioxaborolane, 97%Synonym: IUPAC Name : 1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)piperidineCAS NO.:1264198-72-2Molecular Weight : Molecular formula: C12H24BNO2Smiles: CN1CCC(CC1)B1OC(C)(C)C(C)(C)O1Description: Mevastatin CHAPS PMID:23381601
Product Name : 2,5-Dimethyl-2,5-hexanediol, 97%Synonym: IUPAC Name : 2,5-dimethylhexane-2,5-diolCAS NO.:110-03-2Molecular Weight : Molecular formula: C8H18O2Smiles: CC(C)(O)CCC(C)(C)ODescription: Citalopram hydrobromide Zotiraciclib PMID:23008002
Product Name : Iridium wire, 0.075mm (0.003in) dia, 99.9% (metals basis)Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: GLP-1 receptor agonist 2 Luciferase PMID:24238102 MedChemExpress (MCE)…
Product Name : 4,4''-Diamino-p-terphenyl, 95%Synonym: IUPAC Name : 4'-(4-aminophenyl)--4-amineCAS NO.:3365-85-3Molecular Weight : Molecular formula: C18H16N2Smiles: NC1=CC=C(C=C1)C1=CC=C(C=C1)C1=CC=C(N)C=C1Description: Coronatine Pergolide mesylate PMID:23460641 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : 1-Aminopiperidine, 97%Synonym: IUPAC Name : piperidin-1-amineCAS NO.:2213-43-6Molecular Weight : Molecular formula: C5H12N2Smiles: NN1CCCCC1Description: DAPT Sutimlimab PMID:23775868 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : IGEPAL|r CA-630Synonym: triton X polyoxyethylene (11) octyl phenyl ether polyoxyethylene (9) octylphenyl ether hydrol SW poletoxol peg-12 octyl phenyl ether triton X-102 ortho-gynol octoxynol octylphenoxypolyethoxyethanolIUPAC Name :…
Product Name : (R)-3-Boc-4-methyl-2,2-dioxo-1,2,3-oxathiazolidine, 97%Synonym: IUPAC Name : CAS NO.Olverembatinib :Molecular Weight : Molecular formula: Smiles: Description: Thiazoles are used in peptide research.Caffeic acid phenethyl ester Mainly used in medicine…
Product Name : Toluene-2,4-diisocyanate, tech. 80%, remainder 2,6-diisocyanateSynonym: IUPAC Name : 2,4-diisocyanato-1-methylbenzeneCAS NO.CITCO :584-84-9Molecular Weight : Molecular formula: C9H6N2O2Smiles: CC1=CC=C(C=C1N=C=O)N=C=ODescription: Toluene diisocyanate is utilized in polyurethane foams and tank trucks.Wogonin…
Product Name : 502 Bad GatewaySynonym: IUPAC Name : molybdenumCAS NO.:7439-98-7Molecular Weight : Molecular formula: MoSmiles: Description: Docetaxel Escitalopram PMID:24624203 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : Platinum Iridium wire, 0.5mm (0.02in) dia, hardSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Fruquintinib Anti-Mouse CD8 beta Antibody PMID:23008002 MedChemExpress (MCE) offers…
Product Name : 1-(4-Chlorophenyl)-1-methylethylamine, 97%Synonym: IUPAC Name : CAS NO.Tebotelimab :17797-11-4Molecular Weight : Molecular formula: Smiles: Description: Toceranib PMID:23776646 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : Gold nanoparticles, 50nm, supplied in 0.1mM PBS, 95%, OD1, 535nm absorptionSynonym: IUPAC Name : CAS NO.Ociperlimab :Molecular Weight : Molecular formula: Smiles: Description: For conjugate development by…
Product Name : 1-Naphthylamine hydrochloride, 98%Synonym: IUPAC Name : hydrogen naphthalen-1-amine chlorideCAS NO.:552-46-5Molecular Weight : Molecular formula: C10H10ClNSmiles: .Polydatin .Donepezil Hydrochloride NC1=C2C=CC=CC2=CC=C1Description: Applied as a synthesis reagent.PMID:24578169
Product Name : 4,4,5,5,5-Pentafluoropentan-1-ol, 95%Synonym: IUPAC Name : 4,4,5,5,5-pentafluoropentan-1-olCAS NO.Oleic acid :148043-73-6Molecular Weight : Molecular formula: C5H7F5OSmiles: OCCCC(F)(F)C(F)(F)FDescription: Camrelizumab PMID:24257686
Product Name : 3-chloro-5-fluoroaniline, 97%Synonym: IUPAC Name : 3-chloro-5-fluoroanilineCAS NO.Hypericin :4863-91-6Molecular Weight : Molecular formula: C6H5ClFNSmiles: NC1=CC(F)=CC(Cl)=C1Description: Piroxicam PMID:30125989
Product Name : 4-Hydroxy-3-methylbenzaldehyde, 98%Synonym: IUPAC Name : CAS NO.Olorofim :15174-69-3Molecular Weight : Molecular formula: Smiles: Description: Umeclidinium bromide PMID:23910527 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : Glycolaldehyde dimethyl acetal, 98%Synonym: IUPAC Name : 2,2-dimethoxyethan-1-olCAS NO.:30934-97-5Molecular Weight : Molecular formula: C4H10O3Smiles: COC(CO)OCDescription: Glycolaldehyde dimethyl acetal is used in the preparation of aceto- xyacetaldehyde dimethyl…
Product Name : N6-Benzoyl-5'-O-(4,4'-dimethoxytrityl)-2'-fluoro-2'-deoxyadenosine-3'-(2-cyanoethyl diisopropylphosphoramidite), 98%Synonym: IUPAC Name : N-{9--5-(2-cyanoethoxy)phosphanyl}oxy)methyl]-3-fluorooxolan-2-yl]-9H-purin-6-yl}benzamideCAS NO.Fluorinert FC-40 :136834-22-5Molecular Weight : Molecular formula: C47H51FN7O7PSmiles: COC1=CC=C(C=C1)C(O1(COP(OCCC#N)N(C(C)C)C(C)C)O(1F)N1C=NC2=C(NC(=O)C3=CC=CC=C3)N=CN=C12)(C1=CC=CC=C1)C1=CC=C(OC)C=C1Description: Midostaurin PMID:24578169
Product Name : Phenylmethanesulfonyl fluoride, 99%Synonym: IUPAC Name : phenylmethanesulfonyl fluorideCAS NO.Bovine Serum Albumin :329-98-6Molecular Weight : Molecular formula: C7H7FO2SSmiles: FS(=O)(=O)CC1=CC=CC=C1Description: Delavirdine mesylate PMID:28440459
Product Name : 5-Iodo-1,2,3-trimethoxybenzene, 97%Synonym: IUPAC Name : 5-iodo-1,2,3-trimethoxybenzeneCAS NO.Lisinopril dihydrate :25245-29-8Molecular Weight : Molecular formula: C9H11IO3Smiles: COC1=CC(I)=CC(OC)=C1OCDescription: 5-Iodo-1,2,3-trimethoxybenzene is used as a primary and secondary intermediate in organic synthesis.Norepinephrine…
Product Name : 4-Amino-5-bromo-2-hydroxypyrimidine, 98%Synonym: IUPAC Name : 6-amino-5-bromo-1,2-dihydropyrimidin-2-oneCAS NO.:2240-25-7Molecular Weight : Molecular formula: C4H4BrN3OSmiles: NC1=C(Br)C=NC(=O)N1Description: 4-Amino-5-bromo-2-hydroxypyrimidine can be used in the synthesis of cross-link products under anaerobic and aerobic…
Product Name : Titanium slug, 6.35mm (0.25 in.) dia. x 6.35mm (0.25 in.) length, 99.98% (metals basis)Synonym: IUPAC Name : titaniumCAS NO.:7440-32-6Molecular Weight : Molecular formula: TiSmiles: Description: Tropicamide Ondansetron…
Product Name : Diaion™ UBK550(Na), ion exchange fractionation resin, 8% cross-linked, strongly acidic gel type, 1.9 meq/ml on PS-DVBSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description:…
Product Name : Ammonium dihydrogen phosphate, Puratronic™, 99.995% (metals basis)Synonym: IUPAC Name : phosphoric acid amineCAS NO.:7722-76-1Molecular Weight : Molecular formula: H6NO4PSmiles: N.Oclacitinib OP(O)(O)=ODescription: Crystals of this compound are used…
Product Name : Pyridine-d{5}, 100%(Isotopic)Synonym: IUPAC Name : (²H₅)pyridineCAS NO.:7291-22-7Molecular Weight : Molecular formula: C5H5NSmiles: C1=NC()=C()C()=C1Description: S130 Anti-Mouse CD28 Antibody PMID:35954127
Product Name : Methyl cellulose, viscosity 1600 cPsSynonym: IUPAC Name : 3,4,5-trimethoxy-2-(methoxymethyl)-6-{oxy}oxaneCAS NO.:9004-67-5Molecular Weight : Molecular formula: C20H38O11Smiles: COCC1OC(OC2C(COC)OC(OC)C(OC)C2OC)C(OC)C(OC)C1OCDescription: Thickener and emulsifier in various food and cosmetic products, and also…
Product Name : 1-Acetylpiperidine-4-carboxylic acid, 98+%Synonym: IUPAC Name : 1-acetylpiperidine-4-carboxylateCAS NO.:25503-90-6Molecular Weight : Molecular formula: C8H12NO3Smiles: CC(=O)N1CCC(CC1)C()=ODescription: Gastrodin Capivasertib PMID:26760947
Product Name : ElacridarSynonym: IUPAC Name : N-{4-phenyl}-5-methoxy-9-oxo-9,10-dihydroacridine-4-carboxamideCAS NO.:143664-11-3Molecular Weight : Molecular formula: C34H33N3O5Smiles: COC1=C2NC3=C(C=CC=C3C(=O)C2=CC=C1)C(=O)NC1=CC=C(CCN2CCC3=CC(OC)=C(OC)C=C3C2)C=C1Description: Salmeterol Polydatin PMID:24238415 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals…
Product Name : N-Boc-3,3-diphenyl-L-alanine, 95%Synonym: IUPAC Name : CAS NO.Anti-Mouse Ly-6G/Ly-6C Antibody :Molecular Weight : Molecular formula: Smiles: Description: FX-11 PMID:23671446 MedChemExpress (MCE) offers a wide range of high-quality research…
Product Name : 3-(Trifluoromethyl)benzylamine, 97%Synonym: IUPAC Name : 1-methanamineCAS NO.Bazedoxifene :2740-83-2Molecular Weight : Molecular formula: C8H8F3NSmiles: NCC1=CC=CC(=C1)C(F)(F)FDescription: OF-1 PMID:35991869
Product Name : N,N,N',N'-Tetramethyl-1,6-hexanediamine, 99%Synonym: IUPAC Name : dimethylamineCAS NO.Olorofim :111-18-2Molecular Weight : Molecular formula: C10H24N2Smiles: CN(C)CCCCCCN(C)CDescription: Dronedarone PMID:24324376
Product Name : Ethyl oxamate, 99%Synonym: IUPAC Name : ethyl carbamoylformateCAS NO.Iopamidol :617-36-7Molecular Weight : Molecular formula: C4H7NO3Smiles: CCOC(=O)C(N)=ODescription: IQ 1 PMID:35116795
Product Name : 7-Methoxycoumarin-4-acetic acidSynonym: IUPAC Name : CAS NO.:62935-72-2Molecular Weight : Molecular formula: Smiles: Description: 7-Methoxycoumarin-4-acetic acid is a precursor to coumarin-type fluorescent reagents. It has been uses as…
Product Name : Tyrphostin B46, 98+%Synonym: IUPAC Name : CAS NO.Pimavanserin :Molecular Weight : Molecular formula: Smiles: Description: Inhibitor of EGF receptor kinase activityCadonilimab PMID:23381601 MedChemExpress (MCE) offers a wide…
Product Name : 3-Cyanopyridine, 98%Synonym: IUPAC Name : pyridine-3-carbonitrileCAS NO.Tenofovir Disoproxil :100-54-9Molecular Weight : Molecular formula: C6H4N2Smiles: N#CC1=CC=CN=C1Description: Paricalcitol PMID:23290930 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : Sodium DL-lactate, 60% w/w aq. soln.Synonym: IUPAC Name : sodium 2-hydroxypropanoateCAS NO.:72-17-3Molecular Weight : Molecular formula: C3H5NaO3Smiles: .CC(O)C()=ODescription: Useful chiral synthon; building block for depsipeptides.Sodium DL-lactate, 60%…
Product Name : Carbachol, 98.3%Synonym: IUPAC Name : 2-(trimethylazaniumyl)ethyl carbamate chlorideCAS NO.:51-83-2Molecular Weight : Molecular formula: C6H15ClN2O2Smiles: .CPDA C(C)(C)CCOC(N)=ODescription: Carbachol is a cholinergic agonist and is used for the treatment…
Product Name : DL-α-Phenylglycine, 99%Synonym: IUPAC Name : 2-amino-2-phenylacetic acidCAS NO.Gastrodin :2835-06-5Molecular Weight : Molecular formula: C8H9NO2Smiles: NC(C(O)=O)C1=CC=CC=C1Description: Griseofulvin PMID:25959043
Product Name : N-Methyldiethanolamine, 99+%Synonym: IUPAC Name : 2-ethan-1-olCAS NO.Lurbinectedin :105-59-9Molecular Weight : Molecular formula: C5H13NO2Smiles: CN(CCO)CCODescription: Isavuconazole PMID:32261617
Product Name : Glassy carbon splinter powder, 20-50 micron, type 1Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Glassy carbon splinter powder is used as such…
Product Name : Ethyl (R)-3-hydroxybutyrate, 98%Synonym: IUPAC Name : ethyl 3-hydroxybutanoateCAS NO.:24915-95-5Molecular Weight : Molecular formula: C6H12O3Smiles: CCOC(=O)CC(C)ODescription: Neomycin sulfate Anle138b PMID:26446225 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : 2,4-Dimethylphenyl isocyanate, 98+%Synonym: IUPAC Name : 1-isocyanato-2,4-dimethylbenzeneCAS NO.:51163-29-2Molecular Weight : Molecular formula: C9H9NOSmiles: CC1=CC(C)=C(C=C1)N=C=ODescription: 2,4-Dimethylphenyl isocyanate is used as a pharmaceutical intermediate.Clopidogrel Chymotrypsin PMID:23880095 MedChemExpress (MCE) offers…
Product Name : 1-Pyrrolidinecarbonyl chloride, 97%Synonym: IUPAC Name : pyrrolidine-1-carbonyl chlorideCAS NO.:1192-63-8Molecular Weight : Molecular formula: C5H8ClNOSmiles: ClC(=O)N1CCCC1Description: Zonisamide Squalene PMID:23710097
Product Name : 2-(Hydroxymethyl)pyridine, 98%Synonym: IUPAC Name : (pyridin-2-yl)methanolCAS NO.:586-98-1Molecular Weight : Molecular formula: C6H7NOSmiles: OCC1=CC=CC=N1Description: EIPA Erlotinib Hydrochloride PMID:24101108
Product Name : Indium(I) bromide, ultra dry, 99.998% (metals basis)Synonym: IUPAC Name : indium(3+) tribromideCAS NO.2,8-Dihydroxyadenine :14280-53-6Molecular Weight : Molecular formula: Br3InSmiles: .Fosinopril sodium .PMID:23849184 .Description:
Product Name : 4-(Dimethylamino)piperidine, 97%Synonym: IUPAC Name : CAS NO.Spesolimab :50533-97-6Molecular Weight : Molecular formula: Smiles: Description: 4-(Dimethylamino)piperidine is having molecular features associated with polyamine modulation of N-methyl-D-aspartate receptors.Ciclopirox It…
Product Name : 4-Fluoro-N-Fmoc-L-phenylalanine, 95%Synonym: IUPAC Name : (2S)-2-({carbonyl}amino)-3-(4-fluorophenyl)propanoic acidCAS NO.:169243-86-1Molecular Weight : Molecular formula: C24H20FNO4Smiles: OC(=O)(CC1=CC=C(F)C=C1)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12Description: 4-Fluoro-N-Fmoc-L-phenylalanine derivative was introduced in collaboration with Yu and coworkers in reflection to…
Product Name : 2,2,4-Trimethyl-1,3-dioxolane, 99%Synonym: IUPAC Name : CAS NO.Tipranavir :1193-11-9Molecular Weight : Molecular formula: Smiles: Description: Clavulanic acid PMID:24059181 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : Phenylethyl 3,4-dihydroxycinnamate, 98+%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Phenylethyl 3,4-dihydroxycinnamate is a potent and specific inhibitor of nuclear transcription factor, NF-κB,…
Product Name : 4-Nitrobenzyl bromide, 99%Synonym: IUPAC Name : 1-(bromomethyl)-4-nitrobenzeneCAS NO.:100-11-8Molecular Weight : Molecular formula: C7H6BrNO2Smiles: (=O)C1=CC=C(CBr)C=C1Description: TBB Dapsone PMID:23600560
Product Name : 2,4-Difluoroaniline, 99%Synonym: IUPAC Name : 2,4-difluoroanilineCAS NO.C 87 :367-25-9Molecular Weight : Molecular formula: C6H5F2NSmiles: NC1=CC=C(F)C=C1FDescription: Drotaverine (hydrochloride) PMID:24278086
Product Name : 1-Ethyl-3-methyl-1H-pyrazole-5-carboxylic acid, 97%Synonym: IUPAC Name : 1-ethyl-3-methyl-1H-pyrazole-5-carboxylateCAS NO.Cefditoren (Pivoxil) :50920-65-5Molecular Weight : Molecular formula: C7H9N2O2Smiles: CCN1N=C(C)C=C1C()=ODescription: Lusutrombopag PMID:35901518
Product Name : Methyl sulfoxide-d6, for NMR, with 1% TMS, in 0.75 ml ampoules, 99.9 atom% DSynonym: IUPAC Name : (²H₃)methanesulfinyl(²H₃)methaneCAS NO.Resmetirom :2206-27-1Molecular Weight : Molecular formula: C2H6OSSmiles: C()()S(=O)C()()Description: IL-4…
Product Name : N-(Hydroxymethyl)phthalimide, 97%Synonym: IUPAC Name : 2-(hydroxymethyl)-2,3-dihydro-1H-isoindole-1,3-dioneCAS NO.:118-29-6Molecular Weight : Molecular formula: C9H7NO3Smiles: OCN1C(=O)C2=CC=CC=C2C1=ODescription: Romidepsin Clascoterone PMID:24059181 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : 2-Fluorobenzyl bromide, 98%Synonym: IUPAC Name : 1-(bromomethyl)-2-fluorobenzeneCAS NO.:446-48-0Molecular Weight : Molecular formula: C7H6BrFSmiles: FC1=CC=CC=C1CBrDescription: Clavulanic acid Ombitasvir PMID:25147652 MedChemExpress (MCE) offers a wide range of high-quality research…
Product Name : Calixarene, 98%Synonym: IUPAC Name : pentacyclooctacosa-1(25),3,5,7(28),9,11,13(27),15,17,19(26),21,23-dodecaene-25,26,27,28-tetrolCAS NO.Fmoc-Thr(tBu)-OH :74568-07-3Molecular Weight : Molecular formula: C28H24O4Smiles: OC1=C2CC3=CC=CC(CC4=CC=CC(CC5=CC=CC(CC1=CC=C2)=C5O)=C4O)=C3ODescription: Functionalized calixarenes can bind DNA and induce cell transfection.TCEP hydrochloride Calixarenes lend themselves…
Product Name : (R)-(+)-Styrene oxide, 98%Synonym: IUPAC Name : (2R)-2-phenyloxiraneCAS NO.:20780-53-4Molecular Weight : Molecular formula: C8H8OSmiles: C1O1C1=CC=CC=C1Description: It is used to produce a homologated epoxide as part of a synthetic…
Product Name : 4-Fluorophenylacetonitrile, 99%Synonym: IUPAC Name : 2-(4-fluorophenyl)acetonitrileCAS NO.Acitretin :459-22-3Molecular Weight : Molecular formula: C8H6FNSmiles: FC1=CC=C(CC#N)C=C1Description: NLRP1, Human PMID:23775868
Product Name : N-Boc-2-methyl-L-serine, 97%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: N-Boc-2-methyl-L-serine is used as a cocatalyst in the Diels-Alder reactions between cyclopentadiene and methyl…
Product Name : 4-Methoxybenzenethiol, 98%Synonym: IUPAC Name : 4-methoxybenzene-1-thiolCAS NO.Pelabresib :696-63-9Molecular Weight : Molecular formula: C7H8OSSmiles: COC1=CC=C(S)C=C1Description: Pioglitazone PMID:25269910 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : 5-Fluoro-2-nitroaniline, 97%Synonym: IUPAC Name : 5-fluoro-2-nitroanilineCAS NO.:2369-11-1Molecular Weight : Molecular formula: C6H5FN2O2Smiles: NC1=CC(F)=CC=C1()=ODescription: 5-Fluoro-2-nitroaniline as a intermediate in organic synthesis.Paliperidone Valecobulin hydrochloride PMID:24455443 MedChemExpress (MCE) offers a…
Product Name : Molybdenum sputtering target, 76.2mm (3.0in) dia x 3.18mm (0.125in) thick, 99.95% (metals basis)Synonym: IUPAC Name : molybdenumCAS NO.Prostaglandin E1 :7439-98-7Molecular Weight : Molecular formula: MoSmiles: Description: Rezvilutamide…
Product Name : 4-Methoxypiperidine, 98+%Synonym: IUPAC Name : 4-methoxypiperidineCAS NO.:4045-24-3Molecular Weight : Molecular formula: C6H13NOSmiles: COC1CCNCC1Description: Nitrendipine Unesbulin PMID:23664186
Product Name : (S)-(+)-2,3-O-Isopropylideneglycerol, 98%Synonym: IUPAC Name : (2,2-dimethyl-1,3-dioxolan-4-yl)methanolCAS NO.:22323-82-6Molecular Weight : Molecular formula: C6H12O3Smiles: CC1(C)OCC(CO)O1Description: (S)-(+)-2,3-O-Isopropylideneglycerol acts as a MEK inhibitor with antitumor activity.Olokizumab It is also employed in…
Product Name : 2,3,5-Tri-O-benzyl-beta-D-ribofuranose, 98%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Apolipoprotein A-I Protein, Human Azaserine PMID:32926338
Product Name : trans-2-Hexene, 98+%Synonym: IUPAC Name : (2E)-hex-2-eneCAS NO.:4050-45-7Molecular Weight : Molecular formula: C6H12Smiles: CCCC=CCDescription: Ensitrelvir Taldefgrobep alfa PMID:25558565 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : Aluminum oxide, neutral, HPLC Flash GradeSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Aluminum oxide is used as an adsorbent, desiccating agent, and…
Product Name : Palladium Silver foil, 0.025mm (0.001 in.) thick, 99.9% (metals basis excluding Pt)Synonym: IUPAC Name : CAS NO.Spermine :Molecular Weight : Molecular formula: Smiles: Description: Figitumumab PMID:24733396 MedChemExpress…
Product Name : Sodium cyanoborohydride, 1M solution in THF, AcroSeal™Synonym: IUPAC Name : CAS NO.:25895-60-7Molecular Weight : Molecular formula: Smiles: Description: Tetracycline Tecovirimat PMID:23381626
Product Name : 2,6-Dimethyl-4-nitrophenol, 98%Synonym: IUPAC Name : 2,6-dimethyl-4-nitrophenolCAS NO.:2423-71-4Molecular Weight : Molecular formula: C8H9NO3Smiles: CC1=CC(=CC(C)=C1O)()=ODescription: It was used as internal standard in determination of 4-nitrophenol and 3-methyl-4-nitrophenol in human…
Product Name : Cobalt powder, -60 mesh, 99.5% (metals basis)Synonym: IUPAC Name : cobaltCAS NO.Insulin (human) :7440-48-4Molecular Weight : Molecular formula: CoSmiles: Description: Gimeracil PMID:35567400
Product Name : (1-Tetradecyl)trimethylammonium chloride, 98%Synonym: IUPAC Name : trimethyl(tetradecyl)azanium chlorideCAS NO.Tofacitinib citrate :4574-04-3Molecular Weight : Molecular formula: C17H38ClNSmiles: .Etoposide CCCCCCCCCCCCCC(C)(C)CDescription: PMID:25269910 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : Sea sand, WashedSynonym: IUPAC Name : silanedioneCAS NO.Ribociclib :14808-60-7Molecular Weight : Molecular formula: O2SiSmiles: O==ODescription: Abacavir sulfate PMID:24633055 MedChemExpress (MCE) offers a wide range of high-quality research…
Product Name : Naphthalene-1,4,5,8-tetracarboxylic acid dianhydride, 97%Synonym: IUPAC Name : 6,13-dioxatetracyclohexadeca-1,3,8,10,15-pentaene-5,7,12,14-tetroneCAS NO.:81-30-1Molecular Weight : Molecular formula: C14H4O6Smiles: O=C1OC(=O)C2=CC=C3C(=O)OC(=O)C4=CC=C1C2=C34Description: Naphthalene-1,4,5,8-tetracarboxylic acid dianhydride is used as a reagent in the preparation of…
Product Name : 3-Hydroxy-2-naphthoic acid hydrazide, 98%Synonym: IUPAC Name : 3-hydroxynaphthalene-2-carbohydrazideCAS NO.:5341-58-2Molecular Weight : Molecular formula: C11H10N2O2Smiles: NNC(=O)C1=C(O)C=C2C=CC=CC2=C1Description: 6-Mercaptopurine TD-165 PMID:24059181
Product Name : 4-Bromotriphenylamine, 99%Synonym: IUPAC Name : 4-bromo-N,N-diphenylanilineCAS NO.G-1 :36809-26-4Molecular Weight : Molecular formula: C18H14BrNSmiles: BrC1=CC=C(C=C1)N(C1=CC=CC=C1)C1=CC=CC=C1Description: Corn oil PMID:23291014
Product Name : 1-Ethynylcyclopentanol, 98+%Synonym: IUPAC Name : 1-ethynylcyclopentan-1-olCAS NO.Ibezapolstat :17356-19-3Molecular Weight : Molecular formula: C7H10OSmiles: OC1(CCCC1)C#CDescription: 1-Ethynylcyclopentanol is used in organic synthesis.Teriparatide PMID:24275718
Product Name : 4-Pyrazolecarboxylic acid, 97%Synonym: IUPAC Name : 1H-pyrazole-4-carboxylic acidCAS NO.:37718-11-9Molecular Weight : Molecular formula: C4H4N2O2Smiles: OC(=O)C1=CNN=C1Description: Ladiratuzumab Leniolisib PMID:23710097
Product Name : Sodium hexachloroplatinate(IV) hexahydrate, 98%Synonym: IUPAC Name : disodium hexachloroplatinum hexahydrateCAS NO.:19583-77-8Molecular Weight : Molecular formula: Cl6H12Na2O6PtSmiles: O.Raltegravir O.Saroglitazar O.PMID:23789847 O.O.O...Cl(Cl)(Cl)(Cl)(Cl)ClDescription:
Product Name : Oxacillin sodium salt monohydrate, 815^mg/mgSynonym: IUPAC Name : sodium (2S,5R,6R)-3,3-dimethyl-6-(5-methyl-3-phenyl-1,2-oxazole-4-amido)-7-oxo-4-thia-1-azabicycloheptane-2-carboxylate hydrateCAS NO.:7240-38-2Molecular Weight : Molecular formula: C19H20N3NaO6SSmiles: O..CC1=C(C(=O)N23SC(C)(C)(N3C2=O)C()=O)C(=NO1)C1=CC=CC=C1Description: Used primarily against Gram-positive organisms namely resistant Staphylococcus speciesAfoxolaner…
Product Name : Benzophenone, 99+%, pureSynonym: IUPAC Name : diphenylmethanoneCAS NO.:119-61-9Molecular Weight : Molecular formula: C13H10OSmiles: O=C(C1=CC=CC=C1)C1=CC=CC=C1Description: 4-Hydroxynonenal Adenosine receptor antagonist 2 PMID:25804060
Product Name : Tris(dioxa-3,6-heptyl)amine, 95%Synonym: IUPAC Name : 8--2,5,11,14-tetraoxa-8-azapentadecaneCAS NO.:70384-51-9Molecular Weight : Molecular formula: C15H33NO6Smiles: COCCOCCN(CCOCCOC)CCOCCOCDescription: D-Panthenol 2,8-Dihydroxyadenine PMID:24518703
Product Name : Cesium, 99.98% (metals basis)Synonym: IUPAC Name : caesiumCAS NO.Lornoxicam :7440-46-2Molecular Weight : Molecular formula: CsSmiles: Description: Piroxicam PMID:23833812
Product Name : Lead wire, 0.5mm (0.02in) dia, Puratronic™, 99.998% (metals basis)Synonym: IUPAC Name : leadCAS NO.:7439-92-1Molecular Weight : Molecular formula: PbSmiles: Description: Anti-Mouse TCR gamma/delta Antibody BET bromodomain inhibitor…
Product Name : 4-(2-Aminoethyl)morpholine, 98+%Synonym: IUPAC Name : 2-(morpholin-4-yl)ethan-1-amineCAS NO.:2038-03-1Molecular Weight : Molecular formula: C6H14N2OSmiles: NCCN1CCOCC1Description: Oseltamivir phosphate Mirvetuximab soravtansine PMID:24635174
Product Name : Magnesium stearate (vegetable based), Hyqual™, GenAR™, NF, GMP, Macron Fine Chemicals™Synonym: Stearic acid Magnesium(II) salt, Stearic acid magnesium salt, Magnesium(II) StearateIUPAC Name : CAS NO.Saxagliptin :557-04-0Molecular Weight…
Product Name : Molecular sieves, 4A, 3-4mm (0.12-0.16in) dia. pelletsSynonym: 2--5-methoxy-4-(methoxycarbonyl)-3-methyl-5-oxopentanoic acidIUPAC Name : Molecular sievesCAS NO.:70955-01-0Molecular Weight : Molecular formula: Smiles: Description: Molecular sieves, 4 Å… is used to…
Product Name : 2-Chloro-5-nitroaniline, 98%Synonym: IUPAC Name : 2-chloro-5-nitroanilineCAS NO.:6283-25-6Molecular Weight : Molecular formula: C6H5ClN2O2Smiles: NC1=CC(=CC=C1Cl)()=ODescription: Idarubicin hydrochloride Abietic acid PMID:23847952
Product Name : 2,4,6-Tri-tert-butylaniline, 95%Synonym: IUPAC Name : 2,4,6-tri-tert-butylanilineCAS NO.:961-38-6Molecular Weight : Molecular formula: C18H31NSmiles: CC(C)(C)C1=CC(=C(N)C(=C1)C(C)(C)C)C(C)(C)CDescription: 2,4,6-Tri-tert-butylnitrobenzene (bulky amine) is used in the synthesis of monomeric iminophosphoraneTrilostane Quercetin PMID:23962101
Product Name : Copper(I) chloride, 99.999% (metals basis)Synonym: IUPAC Name : λ¹-copper(1+) chlorideCAS NO.Telisotuzumab :7758-89-6Molecular Weight : Molecular formula: ClCuSmiles: .Description: Copper(I) chloride is precursor to many copper compounds including…
Product Name : (S)-(+)-O-Acetylmandelic acid, 99%Synonym: IUPAC Name : CAS NO.Eblasakimab :7322-88-5Molecular Weight : Molecular formula: Smiles: Description: Otilonium bromide PMID:23539298
Product Name : Dichloromethane, 99.9%, for biochemistry, stabilized with approx. 50 ppm amylene, AcSynonym: IUPAC Name : dichloromethaneCAS NO.:75-09-2Molecular Weight : Molecular formula: CH2Cl2Smiles: ClCClDescription: Tozorakimab C6 Ceramide PMID:24423657
Product Name : Triethylamine, 99%Synonym: IUPAC Name : triethylamineCAS NO.:121-44-8Molecular Weight : Molecular formula: C6H15NSmiles: CCN(CC)CCDescription: Triethylamine is a base used to prepare esters and amides from acyl chlorides as…
Product Name : Crystal violet, ACS reagentSynonym: IUPAC Name : CAS NO.:548-62-9Molecular Weight : Molecular formula: Smiles: Description: Fenoprofen TOPS PMID:25105126
Product Name : 2-Methylanthraquinone, 97%Synonym: IUPAC Name : 2-methyl-9,10-dihydroanthracene-9,10-dioneCAS NO.:84-54-8Molecular Weight : Molecular formula: C15H10O2Smiles: CC1=CC=C2C(=O)C3=CC=CC=C3C(=O)C2=C1Description: 2-Methylanthraquinone is used as a pharmaceutical intermediate.Calcitonin (salmon) It is used in smog dyes.Atracurium…
Product Name : 2,5-Dichloro-3-nitropyridine, 97%Synonym: IUPAC Name : 2,5-dichloro-3-nitropyridineCAS NO.:21427-62-3Molecular Weight : Molecular formula: C5H2Cl2N2O2Smiles: (=O)C1=CC(Cl)=CN=C1ClDescription: Boceprevir Larotrectinib sulfate PMID:25818744
Product Name : Cyclopentanecarboxylic acid, 99%Synonym: IUPAC Name : cyclopentanecarboxylic acidCAS NO.5-Aminosalicylic Acid :3400-45-1Molecular Weight : Molecular formula: C6H10O2Smiles: OC(=O)C1CCCC1Description: Citric acid PMID:24423657
Product Name : Ndelta-Boc-L-ornithine, 98%Synonym: IUPAC Name : 2-amino-5-{amino}pentanoic acidCAS NO.:13650-49-2Molecular Weight : Molecular formula: C10H20N2O4Smiles: CC(C)(C)OC(=O)NCCCC(N)C(O)=ODescription: NPX800 AEBSF hydrochloride PMID:23695992
Product Name : Vanadium wire, 2.0mm (0.08 in.) dia., 99.5% (metals basis)Synonym: IUPAC Name : vanadiumCAS NO.Tamoxifen :7440-62-2Molecular Weight : Molecular formula: VSmiles: Description: Gedunin PMID:23554582
Product Name : 2,3-Dimethoxy-5-methyl-1,4-benzoquinone, 98%Synonym: IUPAC Name : CAS NO.:605-94-7Molecular Weight : Molecular formula: Smiles: Description: Drospirenone Voxilaprevir PMID:24293312
Product Name : N,N'-Bis(trimethylsilyl)urea, 98+%Synonym: IUPAC Name : CAS NO.:18297-63-7Molecular Weight : Molecular formula: Smiles: Description: N,N'-Bis(trimethylsilyl)urea is used as a reagent for the silylation of alcohols and carboxylic acids.Ingenol…
Product Name : Ethyl 2-aminothiophene-3-carboxylate, 97%Synonym: IUPAC Name : ethyl 2-aminothiophene-3-carboxylateCAS NO.:31891-06-2Molecular Weight : Molecular formula: C7H9NO2SSmiles: CCOC(=O)C1=C(N)SC=C1Description: Ethyl 2-aminothiophene-3-carboxylate is used as an organic chemical synthesis intermediate.Avacopan Cyproheptadine hydrochloride…
Product Name : 4,4'-Dibromotriphenylamine, 98%Synonym: IUPAC Name : 4-bromo-N-(4-bromophenyl)-N-phenylanilineCAS NO.:81090-53-1Molecular Weight : Molecular formula: C18H13Br2NSmiles: BrC1=CC=C(C=C1)N(C1=CC=CC=C1)C1=CC=C(Br)C=C1Description: Honokiol Eculizumab PMID:24025603
Product Name : beta-Nicotinamide adenine dinucleotide phosphate reduced tetrasodium salt, 95%Synonym: IUPAC Name : tetrasodium methyl ({methyl phosphonato}oxy)phosphonateCAS NO.:2646-71-1Molecular Weight : Molecular formula: C21H26N7Na4O17P3Smiles: .Digitoxigenin .Sonelokimab .PMID:24516446 .NC(=O)C1=CN(C=CC1)1O(COP()(=O)OP()(=O)OC2O((OP()()=O)2O)N2C=NC3=C(N)N=CN=C23)(O)1ODescription: NADPH tetra…
Product Name : N-Octyl-N,N-dimethyl-3-ammonio-1-propanesulfonate, 98%Synonym: IUPAC Name : 3-propane-1-sulfonateCAS NO.:15178-76-4Molecular Weight : Molecular formula: C13H29NO3SSmiles: CCCCCCCC(C)(C)CCCS()(=O)=ODescription: AK-7 Canthaxanthin PMID:30125989
Product Name : 4-Hydroxy-3,5-dimethylbenzonitrile, 98%Synonym: IUPAC Name : 4-hydroxy-3,5-dimethylbenzonitrileCAS NO.:4198-90-7Molecular Weight : Molecular formula: C9H9NOSmiles: CC1=CC(=CC(C)=C1O)C#NDescription: Relatlimab Irbesartan PMID:23983589
Product Name : 1-Bromo-4-n-propylbenzene, 99%Synonym: IUPAC Name : 1-bromo-4-propylbenzeneCAS NO.:588-93-2Molecular Weight : Molecular formula: C9H11BrSmiles: CCCC1=CC=C(Br)C=C1Description: Sparfloxacin Inolimomab PMID:24631563
Product Name : (α,α,α-Trifluoro-p-tolyl)acetic acid, 98%Synonym: IUPAC Name : CAS NO.:32857-62-8Molecular Weight : Molecular formula: Smiles: Description: Omidenepag Ticagrelor PMID:23903683
Product Name : Tin, plasma standard solution, Specpure™ Sn 1000μg/mLSynonym: IUPAC Name : CAS NO.Dipyridamole :Molecular Weight : Molecular formula: Smiles: Description: Olacaftor PMID:25959043
Product Name : 3,3-Dimethylacrylic acid, 98%Synonym: IUPAC Name : 3-methylbut-2-enoic acidCAS NO.Adenosine :541-47-9Molecular Weight : Molecular formula: C5H8O2Smiles: CC(C)=CC(O)=ODescription: Chemical Intermediates.Ceritinib PMID:24624203
Product Name : 3-Methyl-1-butyne, 96%Synonym: IUPAC Name : 3-methylbut-1-yneCAS NO.:598-23-2Molecular Weight : Molecular formula: C5H8Smiles: CC(C)C#CDescription: 3-Methyl-1-butyne is a terminal alkyne that under goes hydrosilylation reaction using phenylsilane.Gomisin M1 3-Methyl-1-butyne…
Product Name : Thulium pieces, sublimed dendritic, 99.9% (REO)Synonym: IUPAC Name : thuliumCAS NO.:7440-30-4Molecular Weight : Molecular formula: TmSmiles: Description: Tipranavir Relatlimab PMID:23509865
Product Name : Niobium sputtering target, 50.8mm (2.0in) dia x 3.18mm (0.125in) thick, 99.95% (metals basis excluding Ta)Synonym: IUPAC Name : niobiumCAS NO.Amisulpride :7440-03-1Molecular Weight : Molecular formula: NbSmiles: Description:…
Product Name : 2-Fluoro-6-methylbenzaldehyde, 97%Synonym: IUPAC Name : CAS NO.:117752-04-2Molecular Weight : Molecular formula: Smiles: Description: Remibrutinib Pafolacianine PMID:24516446
Product Name : Tetrabutylammonium chloride, 95%, Tech., contains also bromideSynonym: IUPAC Name : tetrabutylazanium chlorideCAS NO.Fostamatinib Disodium :1112-67-0Molecular Weight : Molecular formula: C16H36ClNSmiles: .Fluorescein-5-maleimide CCCC(CCCC)(CCCC)CCCCDescription: PMID:23833812
Product Name : Tetracyanoethylene, 98%Synonym: IUPAC Name : eth-1-ene-1,1,2,2-tetracarbonitrileCAS NO.Baclofen :670-54-2Molecular Weight : Molecular formula: C6N4Smiles: N#CC(C#N)=C(C#N)C#NDescription: G36 PMID:24367939
Product Name : n-Octadecane, tech., 90%Synonym: IUPAC Name : octadecaneCAS NO.:593-45-3Molecular Weight : Molecular formula: C18H38Smiles: CCCCCCCCCCCCCCCCCCDescription: n-octadecane is used as a solvent, a lubricant, transformer oil and an anti-corrosion…
Product Name : Dimethyl 3-nitrophthalate, 98%Synonym: IUPAC Name : 1,2-dimethyl 3-nitrobenzene-1,2-dicarboxylateCAS NO.Dapansutrile :13365-26-9Molecular Weight : Molecular formula: C10H9NO6Smiles: COC(=O)C1=CC=CC(=C1C(=O)OC)()=ODescription: B-Raf IN 10 PMID:32472497
Product Name : 1,2,3-Tri-O-acetyl-5-deoxy-beta-D-ribofuranose, 98%Synonym: IUPAC Name : CAS NO.:62211-93-2Molecular Weight : Molecular formula: Smiles: Description: D-Cycloserine PA-9 PMID:24182988
Product Name : 2-Imidazolidinethione, 98%Synonym: IUPAC Name : imidazolidine-2-thioneCAS NO.:96-45-7Molecular Weight : Molecular formula: C3H6N2SSmiles: S=C1NCCN1Description: Resibufogenin (-)-Epigallocatechin Gallate PMID:24238102
Product Name : 2-Bromotetradecane, 95%Synonym: IUPAC Name : 2-bromotetradecaneCAS NO.Inorganic pyrophosphatase :74036-95-6Molecular Weight : Molecular formula: C14H29BrSmiles: CCCCCCCCCCCCC(C)BrDescription: Mifepristone PMID:23074147
Product Name : Barium perchlorate, anhydrousSynonym: IUPAC Name : barium(2+) diperchlorateCAS NO.:13465-95-7Molecular Weight : Molecular formula: BaCl2O8Smiles: .Anti-Mouse Ly-6G/Ly-6C Antibody (=O)(=O)=O.(=O)(=O)=ODescription: Barium perchlorate, anhydrous is used to make explosives.Aflibercept (VEGF…
Product Name : cis-2,6-Dimethylmorpholine, 97%Synonym: IUPAC Name : (2R,6S)-2,6-dimethylmorpholin-4-iumCAS NO.Fosamprenavir :6485-55-8Molecular Weight : Molecular formula: C6H14NOSmiles: C1CC(C)O1Description: Atropine sulfate monohydrate PMID:24118276
Product Name : (Benzoylmethylene)triphenylphosphorane, 98+%Synonym: IUPAC Name : 1-phenyl-2-(triphenyl-λ⁵-phosphanylidene)ethan-1-oneCAS NO.Fitusiran :859-65-4Molecular Weight : Molecular formula: C26H21OPSmiles: O=C(C=P(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1)C1=CC=CC=C1Description: It is used in organic synthesis, wittig reagent.Azithromycin PMID:23671446
Product Name : 4-Nitrophenyl formate, 98%Synonym: IUPAC Name : 4-nitrophenyl formateCAS NO.:1865-01-6Molecular Weight : Molecular formula: C7H5NO4Smiles: (=O)C1=CC=C(OC=O)C=C1Description: Convenient and selective reagent for the selective formylation of terminal amino groups…
Product Name : Anthracene-9-carboxylic acid, 99%Synonym: IUPAC Name : anthracene-9-carboxylic acidCAS NO.Oseltamivir phosphate :723-62-6Molecular Weight : Molecular formula: C15H10O2Smiles: OC(=O)C1=C2C=CC=CC2=CC2=CC=CC=C12Description: Pibrentasvir PMID:35670838
Product Name : Tetraethylammonium hydroxide, 25% w/w in methanolSynonym: IUPAC Name : tetraethylazanium hydroxideCAS NO.:77-98-5Molecular Weight : Molecular formula: C8H21NOSmiles: .CC(CC)(CC)CCDescription: It is used as a phase transfer catalyst, the…
Product Name : 2'-Iodoacetophenone, 98+%Synonym: IUPAC Name : 1-(2-iodophenyl)ethan-1-oneCAS NO.:2142-70-3Molecular Weight : Molecular formula: C8H7IOSmiles: CC(=O)C1=CC=CC=C1IDescription: Atomoxetine hydrochloride Dienogest PMID:28322188
Product Name : Thapsigargin, 97%Synonym: IUPAC Name : (3S,3aR,4S,6S,6aR,7S,8S,9bS)-6-(acetyloxy)-4-(butanoyloxy)-3,3a-dihydroxy-3,6,9-trimethyl-8-{oxy}-2-oxo-2H,3H,3aH,4H,5H,6H,6aH,7H,8H,9bH-azulenofuran-7-yl octanoateCAS NO.Regorafenib :67526-95-8Molecular Weight : Molecular formula: C34H50O12Smiles: CCCCCCCC(=O)O1(OC(=O)C(\C)=C/C)C(C)=C23OC(=O)(C)(O)3(O)(C(C)(OC(C)=O)12)OC(=O)CCCDescription: Cibinetide PMID:26760947
Product Name : Gold wire, 1.0mm (0.04in) dia, Premion™, 99.999% (metals basis)Synonym: IUPAC Name : goldCAS NO.Islatravir :7440-57-5Molecular Weight : Molecular formula: AuSmiles: Description: Maraviroc PMID:35850484
Product Name : 1-(3-Chloro-2-pyridyl)piperazine, 98%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Fengycin Pertuzumab PMID:24360118
Product Name : 10,12-Tricosadiynoic acid, 96%Synonym: IUPAC Name : CAS NO.:66990-30-5Molecular Weight : Molecular formula: Smiles: Description: It is an active pharmaceutical intermediate.Sarolaner Nimesulide PMID:23800738
Product Name : Potassium tert-pentyloxide, 25% w/w in tolueneSynonym: IUPAC Name : potassium 2-methylbutan-2-olateCAS NO.:41233-93-6Molecular Weight : Molecular formula: C5H11KOSmiles: .Upadacitinib CCC(C)(C)Description: Potassium tert-pentyloxide is a strong, hindered base used…
Product Name : Polyethylene glycol 1,000Synonym: IUPAC Name : CAS NO.:25322-68-3Molecular Weight : Molecular formula: (C2H4O)nSmiles: OCCODescription: Polyethylene glycol is used as an excipent in pharmaceutical products. It is used…
Product Name : 2-Amino-4-fluorobenzoic acid, 98%Synonym: IUPAC Name : 2-amino-4-fluorobenzoateCAS NO.:446-32-2Molecular Weight : Molecular formula: C7H5FNO2Smiles: NC1=CC(F)=CC=C1C()=ODescription: Flurbiprofen Ciclopirox PMID:23439434
Product Name : Benzyltriphenylphosphonium Chloride, 99%Synonym: IUPAC Name : benzyltriphenylphosphanium chlorideCAS NO.:1100-88-5Molecular Weight : Molecular formula: C25H22ClPSmiles: .Verteporfin C(C1=CC=CC=C1)(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1Description: Pirtobrutinib PMID:25959043
Product Name : Salicylaldoxime, 98%Synonym: IUPAC Name : (6Z)-6-cyclohexa-2,4-dien-1-oneCAS NO.Barzolvolimab :94-67-7Molecular Weight : Molecular formula: C7H7NO2Smiles: ON\C=C1\C=CC=CC1=ODescription: Ertapenem sodium PMID:25016614
Product Name : Neopentyl chloride, 98%Synonym: IUPAC Name : 1-chloro-2,2-dimethylpropaneCAS NO.:753-89-9Molecular Weight : Molecular formula: C5H11ClSmiles: CC(C)(C)CClDescription: Neopentyl chloride is a substrate used for quantum mechanics calculations on LinB to…
Product Name : Iron(III) phosphate hydrateSynonym: IUPAC Name : iron(3+) hydrate phosphateCAS NO.:51833-68-2Molecular Weight : Molecular formula: FeH2O5PSmiles: O..P()()=ODescription: Poly(methyl methacrylate) is used in the lenses of exterior lights of…
Product Name : 4-Ethylbenzaldehyde, 97%Synonym: IUPAC Name : 4-ethylbenzaldehydeCAS NO.Atoltivimab :4748-78-1Molecular Weight : Molecular formula: C9H10OSmiles: CCC1=CC=C(C=O)C=C1Description: It is used as a perfuming agent in cosmetics industry.Niraparib It is also…
Product Name : Aluminum sulfate hydrate, 97+%Synonym: IUPAC Name : dialuminium(3+) trisulfateCAS NO.:17927-65-0Molecular Weight : Molecular formula: Al2O12S3Smiles: ..S()(=O)=O.UDP-Galactose S()(=O)=O.Triclosan S()(=O)=ODescription: Aluminum sulfate hydrate is a chemical compound commonly used…
Product Name : tert-Pentylbenzene, 97%Synonym: IUPAC Name : (2-methylbutan-2-yl)benzeneCAS NO.DCVC :2049-95-8Molecular Weight : Molecular formula: C11H16Smiles: CCC(C)(C)C1=CC=CC=C1Description: Afatinib dimaleate PMID:23522542
Product Name : 2,4-Dichloro-6-(trifluoromethyl)pyrimidine , 95%Synonym: IUPAC Name : 2,4-dichloro-6-(trifluoromethyl)pyrimidineCAS NO.:16097-64-6Molecular Weight : Molecular formula: C5HCl2F3N2Smiles: FC(F)(F)C1=CC(Cl)=NC(Cl)=N1Description: Diclofenac Maslinic acid PMID:24563649
Product Name : Chlorogenic acidSynonym: IUPAC Name : (1S,3R,4R,5R)-3-{oxy}-1,4,5-trihydroxycyclohexane-1-carboxylic acidCAS NO.:327-97-9Molecular Weight : Molecular formula: C16H18O9Smiles: O1C(O)(C(OC(=O)\C=C\C2=CC=C(O)C(O)=C2)1O)C(O)=ODescription: Chlorogenic acid is used as a food additive in coffee products, chewing gum…
Product Name : Iron(0) pentacarbonylSynonym: IUPAC Name : pentakis(methanidylidyneoxidanium) ironCAS NO.:13463-40-6Molecular Weight : Molecular formula: C5FeO5Smiles: .Lanadelumab #.Spesolimab #.PMID:24423657 #.#.#Description:
Biofilm formation at higher concentrations ( six.25 or 12.five M) (information not shown). Paradoxical biofilm formation is defined as a resurgence of biofilm formation ( 50 relative to manage treatment)…
On media that lacked all sulfur or sulfate sources. We tested the ability of those strains to replicate applying alkyl sulfate esters as their sole sulfur source. Each the WT…
Pregnancy with no symptoms is estimated to be 5-8 , however the explanation for the lack of symptoms is unknown. . Within a Finnish study, PG recurred in two instances,…
On of numerous components of your insulin receptor signaling pathway in adipose tissue was considerably reduce one particular week just after calving than at five MG. We also showed that…
, 3H, J = 7.1 Hz), 4.14.17 (m, 3H), 6.69.73 (m, 2H), 6.80 (d, 1H, J = 7.8 Hz), 7.16 (d, 1H, J = 7.7 Hz), 7.28 (t, 1H, J…
Tion constrained by chemical parameters, and (B) associations of bacterial neighborhood members with chemical parameters. Constrained analysis of principal coordinates (CAP), working with Bray-Curtis distance, was performed on HaeIII terminal…
Utput neurons on the hippocampus and have been extensively studied with respect to glutamate synaptic transmission, long-term potentiation and depression, studying and memory. The significant excitatory drive of CA1 pyramidal…
, which final results within a Gaussian curve together with the peak at 48 pN (Panel B of Figure 5). These unbinding force data had been comparable with these reported…
That low haemoglobin levels and low blood glucose levels would be the two most reputable haematological parameters in predicting vivax malaria in patients from endemic places. The findings' regarding decreased…
To second-line therapy. This high occurrence of digestive ADR could be partially explained by the population enrolled inside the study considering that black people are identified toCordel et al. Malaria…
G.I.S. wrote the paper. The authors declare no conflict of interest. This informative article is really a PNAS Direct Submission.| cancer therapyhe breast cancer one, early onset (BRCA1) gene is…
Was apparently different in wholesome and pancreatic cancer sufferers for each of your three lectin-enriched samples. SDS-PAGE recognized two bands at 60 kDa and 85 kDa, and an in-gel trypsin…
Ne kinase two (TK2), members from the Janus kinase family of receptor-associated tyrosine kinases. These kinases proceed to phosphorylate signal transducers and activators of transcriptions 1 and two (STAT1 and…
Lue staining and Western blot evaluation making use of antibody specific for the 6 His tag. The protein concentration was measured by the BCA technique and stored at 70 until…
IC population in order to maximize the proportion of participants with plague qualities that can be measured given the resolution limits of MRI. In other words, higher IMT participants have…
Ible for -SPGG-2, despite the fact that a few of these are extra very easily formed than other folks. We reasoned that the potency of -SPGG-2 could possibly be significantly…
Le 3.DNA polymerization assayCompeting interests The authors declare that they have no competing interests. Authors' contributions TB and JG developed and performed research, analyzed information, and drafted the manuscript. BK…
Man, the ribosome/HSF1 circuit is particularly important in supporting the malignant phenotype since it can respond to varied metabolic inputs which are typically dysregulated in cancer (five, 6, 402). This…
Reduces cell proliferation and increases KLF4 and p21 expression in colon cancer cell lines Initially, the effects of GSI remedy on cell proliferation have been investigated in human colon cancer…
Is of numerous kid psychiatric issues, this study revealed weaknesses in detecting TS. Notably, you can find a variety of benefits supplied by structured interviews such as the DISC relative…
0 10Engraftment of human cellsCD45 alone CD3 (of CD45+) CD8 (of CD3+) CD4 (of CD3+)UntreatedBlank NPCCR5-NPbSpleen genomic DNA Engrafted but untreated Allele-specific PCR (donor 597) WT-specific PCR Blank NP CCR5…
Wn that remedy of ovarian tumor antigen-loaded, cytokinematured DC having a mixture of IL-15 along with a p38 MAPK inhibitor presents potent synergy in antagonism of Treg induction and redirection…
T of Nephrology, Provincial Hospital Affiliated to Shandong University, Shandong 250021, P. R. China. 2Department of Thoracic Surgery, Provincial Hospital Affiliated to Shandong University, Shandong, P. R. China. 3 Division…
E points have been according to a weight of 32g in accordance with IACUC protocols.Author Manuscript Author Manuscript Author Manuscript Author ManuscriptNat Med. Author manuscript; offered in PMC 2014 December…
N liver illness. Expression with the precursor of miR-155, BIC can be helpful for the duration of the course of HCV infection and may very well be a useful biomarker…
. Ozturk B, Gunduz OH, Ozoran K, Bostanoglu S. Effect of continuous lumbar traction on the size of herniated disc material in lumbar disc herniation. Rheumatol Int. 2006;26(7):622. Meints SM,…
Ward the inhibitory effects of NgBR knockdown on the viability of HCC cells, a colony formation assay was applied to analyze the clonogenicity of HepG2 and SMMC-7721 cells at 10…
948 is usually a potent inhibitor of TPA-induced MMP-9 expression. Even so, BVT948 blocks only the NF-B activation in MCF-7 cells, but not AP-1. Our outcomes show that BVT948 blocks…
Situation and supplied by Dr. Guy Whitley (St. George's Hospital Healthcare College, London, UK) . SGHPL-4 cells had been cultured in Ham's F-10 media supplemented with ten fetal bovine serum,…
Translocations/ TFE3 gene fusions with concentrate on pathobiological aspect. Histol Histopathol 2012; 27: 133140. Zou H, Pang LJ, Hu WH, Li F, Li HA, Jiang JF, Liang WH, Sun ZZ,…
Ve study involving longer-term biochemical monitoring immediately after discharge of such sufferers will yield further insight concerning the threshold at which acetaminophen-induced hepatotoxicity can take place. Dr Civan serves because…
Ic CLN3 gene (CLN3 plasmids provided by I. Yamashita) and also the BCY1 gene was performed making use of a disruption plasmid. The strains with chromosomally integrated genes for WHI3S568A…
Es within the control mice, but was capable to attenuate the decrease in RBC velocities within the DSS mice. No statistically significant DSS-induced adjustments were observed within the diameters in…
Measurements, the relative threshold algorithm compares every day progesterone levels to baseline levels. The baseline level is usually calculated by averaging every day progesterone concentrations taken on days six to…
Distinctive effects onAcknowledgmentsI am grateful to Associate Professor Gregoryhttp://www.medsci.orgInt. J. Med. Sci. 2013, Vol.Metha, Head of Chemistry and Dr David Wilson, College of Health-related Sciences in the University of Adelaide…
But itAddress for correspondence: Wang Si-Wang, The Fourth Military Health-related University Institute of Materia Medica, Xi'an, China. E-mail: [email protected] distinct in different crude resources. Avula et al. have quantitative determined…
Sed in serum of individuals with amyotrophic lateral sclerosis. J Neuroimmunol 2005, 159(1):14654. 24. Verzola RM, Mesquita RA, Peviani S, Ramos OH, Moriscot AS, Perez SE, Selistre-de-Ara o HS: Early…
By performing random rotations, between 1 and ten , on randomly chosen backbone dihedral angles. The maximum adjust in a dihedral was decreased simultaneously with temperature to a minimum of…
. In pairwise tests of linkage disequilibrium, dhps was in considerable linkage disequilibrium with MS9 (exact test, P 0.05); no other markers have been near the dhps locus. The fact…
G PAS region, indicating that Atg1 might also function independent of its canonical binding partners . Each autophagosome and endosome membranes are positive for phosphatidylinositol 3-phosphate (PI3P), a phospholipid generated…
Ne and its derivatives. Figure 1A demonstrates an increase in hydroethidine fluorescence in the H6c7eR-Kras+ (Kras+) and H6c7eR-KrasT (KrasT) cell lines when in comparison with the H6c7 cells. Furthermore, there…
Ses. In fission yeast, Cdc25 is phosphorylated by Chk1 or Cds1Chk2 in response to DNA harm or replication strain, respectively (22,23). This benefits in Cdc25 nuclear export by means of…
Mposition for concentrations The outcomes derived from the former sections could be transferred to variance decompositions for concentrations immediately if a fixed volume-age partnership is assumed. When volume, V, is…
Nflammatory activation in ALS PBMCs in comparison to handle PBMCs . Inside the existing study, we've tested 10 sporadic ALS individuals and found that one particular half belonged to Group…
Dopamine release for tonic and bursting release occurred beneath 10V stimulation intensity. The MK 801 may have a specific impct on the amantadine effect within the tonic release state (Fig.…
Ells have been plated in triplicate inside a 96 well microtiter plate (BD Bioscience) and permitted to grow for 24 hours to an approximate confluence of 30 . MEK162 and…
The ``peripheral cannabinoid receptor'' based on its abundant expression inside the immune method, in contrast for the ``central cannabinoid receptor'' CB1, which is predominantly expressed inside the central nervous program…
Towards the binding isotherm supplied the equilibrium binding constant (Ka 1/KD) and enthalpy of binding ( H). Depending on the values of Ka, the alter in free of charge energy…
N shown that CRIPTO1 activates SRC upon binding to glypican-1 (36). Our study suggests that CRIPTO1 may perhaps activate SRC by way of downregulation of miR-205 as an option mechanism.…
Uffle technique. Strain CMY02 was transformed using the SSE1 mutagenized plasmid library. Transformed cells were selected on medium lacking leucine. Any red or dark-pink colonies have been scored at this…
The red fluorescence-positive population increased when treated with vitamin C. a Handle; b vitamin C one hundred M, 24 h; c vitamin C one hundred M, 48 h. C Effect…
, CA). Colony Formation Assays Cells were trypsinized into a single-cell suspension. A total of 100 cells were plated in each and every effectively of a 6-well plate and maintained…
Hysiol. Plant Mol. Biol. 2001, 52, 43767. Noctor, G.; Foyer, C.H. Ascorbate and glutathione: Maintaining active oxygen beneath handle. Ann. Rev. Plant Physiol. Plant Mol. Biol. 1998, 49, 24979. Chen,…
Me acidophile Acidithiobacillus ferrooxidans. J Biol Chem 2008, 283(38):258035811. 40. Giudici-Orticoni MT, Leroy G, Nitschke W, Bruschi M: Characterization of a brand new dihemic c(4)-type cytochrome isolated from Thiobacillus ferrooxidans.…
Romoting the generation of hemiaminal intermediates as revealed by our research here. The formation of a hemiaminal also indicates the presence of a labile oxygen at Cdx.doi.org/10.1021/ja505407p | J. Am.…
Not impact plasma transaminases with out causing steatosis in Western diet regime fed wildtype mice. Next we evaluated the effects of miR-30c on plasma lipids and transaminases in female Apoe-/-…
.356 2.323 1.084 Glutamine ( 3) two.553 2.288 2.132 Valine ( 4) 0.831 0.895 0.853 Threonine ( 5) 0.523 0.461 0.The free of charge energy of binding (FIGURE 4. Impact…
Ence of RidA resulted in a significant imbalance inside the metabolic network around pyruvate. Mutants lacking RidA accumulate pyruvate because of lowered coenzyme A levels The activity of transaminase B…
--Protein, /mL Day753.678.ATP, LU x ten / protein Day648.750.Lactate, /mg protein Day1.7.DayDayDay580.837.Day6.5.Day7.0.Day5.6.Day1.7.Day2.six.Imply percentage versus control SE mtDNA ATP8 NRTI Conc, 40 BMS-986001 200 8 d4T 200 two TFV 200 three…
Normality (All have been admitted) (Quantity admitted, ) (Number admitted, ) Alkalosis only (AL) Alkalosis + Lactate (A+L) Acidosis only (AC) Acidosis + Base deficit (AC+BD) Acidosis + Lactate (AC+L)…
Of propagation and utilizing the firm sourdough at 1 day because the reference. A total of 197 volatile elements, which belonged to a variety of chemical classes, were identified via…
N of tartrazine, for instance chromatography , spectrophotometry , electroanalytical approaches , and novel nanosensor detection solutions . However, most of these approaches are expensive, time consuming or complicated, and…
Ene transcription in response to precise Nicotinamide phosphoribosyl transferase (Nampt) is definitely the rate-limiting enzyme in the NAD Using transgenic mouse models, we tested the hypothesis that skeletal muscle Nampt…
(ii) (CH3)3N, MeCN, 65 ; (b) HCl, aq. dioxane; (c) 10-(7-mercapto-4-methylcoumarin)decanoic acidDCC-DMAP, CHCl3; (d) 12-(FMOC)-aminododecanoic acid-DCC-DMAP, CHCl3; (e) (i) DBU, CHCl3, (ii) p-nitrophenyl-7-mercapto-4-methylcoumarin-3-carboxylate, DMAP, CHCl3; (f) (i) as in (e),…
2013,In contrast, the simulations that started from extended conformations needed a lot more time to reach the equilibrium. In the OPLS-AA force field, the number of folded replicas steadily enhanced…
S had been fabricated and characterized.Final results and DiscussionSynthesis of AIMs 1The reaction for the synthesis of IM allows us to acquire a wide array of a variety of IM…
Novartis, and Novo Nordisk. Angela Dardano, Cristina Bianchi and Roberto Miccoli have no conflict of interest to declare. Published online 28 MayNucleic Acids Research, 2013, Vol. 41, Net Server concern…
Tcome. Nonetheless, this concept can be tested in a chemically induced demyelination model of EAE where peripheral inflammation is absent. Studies in our laboratory also recommend that calpain inhibition reduces…
Ncers. Even so, its use is limited as a result of lethal effects of radiation on standard tissues. Thus, attempts had been made earlier to improve the therapeutic effect of…
Ned from the bands of the marker (72200 kDa). The estimated sizes with the bands had been as follows: 1, 2 (4.0 kDa), 3 (38.0 kDa), 4 (14.0 kDa), 5…
3.8 Hz, 1H, H-1 1Fuc), 4.70 (s, 1H, H-1 1Man), 4.68.63 (m, 2H, H-5Fuc, H-1GlcNAc), four.49 (d, J 8.0 Hz, 1H, H-1GlcNAc) five.21 (d, J four.0 Hz, 1H, H-1 1Fuc),…
Otype 1b (2) is significantly lower than for genotype 1a. Using a baseline viral load V0 506 IU/ml, the drug resistant viral load (Vr) is about 10-2 IU/ml before therapy…
Mation. J Bone Miner Res. 2014; 29(four):86677. 23. Osipo C, Golde TE, Osborne BA, Miele LA. Off the beaten pathway: the complicated cross talk amongst Notch and NF-B. Lab Invest.…
Ctions. There is no financial arrangement involving any of your authors. Authors' contributions RR, BA contributed for the conception and design and style with the study; AM, RSR, EA and…
Ion prices had been considerably enhanced in all other cell lines expressing the canine, macaque, and human receptors, including Vero/hSLAM cells (Fig. 1). Therefore, CYN07-hV showed considerably distinct growth kinetics…
E CDH13 variants studied here. We also observed similar expression levels and localization of wild type and variant CDH13 in living HEK293 cells expressing GFP-CDH13 fusion proteins (see supplementary information).…
Ution on the method is instead fundamentally determined by the size from the optical speckles at the ultrasound plane. As a consequence of the low numerical aperture of illumination in…
Chondrial proteins from dcerk1.dsirt2 double mutants show improved acetylation compared with all the single mutants (Fig. 3 C). We then tested how dsirt2 mutant flies respond to situations including starvation…
This strategy, we then investigated whether or not the L166P mutant could affect WT DJ-1 dimerization efficiency. Cells have been transfected with both WT DJ-1 constructs along with either the…
Dose of 800 mg/day but not in the typical anti-inflammatory dose of 200 mg/day bid (23). The possibility that an off-target impact accounts for the chemopreventive activity of NSAIDs could…
Flammation. Consequently, early interventions targeting survivors' social networks could enhance top quality of life during survivorship. Keywords and phrases social support; pain; depressive symptoms; cancer survivors; inflammation; IL-6 Even though…
Ntribute to the activity measured. This was addressed in part by examining the expression of Nox1, Nox2, and Nox4 within the aorta. While the degree of Nox1 mRNA within the…
Tely clear, but COX inhibitor suppression of intramuscular levels of your myokine interleukin-6 (IL-6) along with the ubiquitin ligase muscle RING finger-1 (MuRF-1) appears to play a central function .…
At modulation of insulin levels and insulin sensitivity in these animals must blunt this response. As a proof-of-principle, we initially eliminated insulin production using streptozotocin, a drug toxic to pancreatic…
Lines). Twitch Ca2+ transients are magnified in respective figures for far better evaluation of Ca2+ handling kinetics. doi:10.1371/journal.pone.0076568.gResults Intrinsic Aerobic Capacity and Cardiac ContractilityVO2 max was 24 reduce in LCR…
Cells have been collected by trypsin treatment and counted making use of trypan blue. Ly-294002 (Ly, Biomol) a potent inhibitor of phosphoinositol 3-kinase (PI3K) was dissolved in DMSO (Sigma) and…
Didn't, P .001. As previously reported, PFS6 has been proposed as an alternative endpoint for evaluating sufferers with GBM getting temozolomide.35 The constant metabolite observations for predicting PFS6 in our…
Cells treated with mPA-ZHER2 alone. (B) HER2 receptor levels have been determined by flow cytometry with an FITC-labeled anti-HER2 Affibody. Mean fluorescence intensity was calculated using the FloJo application package…
Pertension who had blood stress checked inside 2 years Prereform 304 (93) 130 (92) 61 (95) 41 (98) Postreform 296 (94) 134 (96) 56 (89) 38 (93) 83 (83) 72…
Cellular supply of IL-24 may perhaps, nevertheless, be far more difficult inside the SCC microenvironment. Th2 cells and macrophages too as melanocytes create IL-24 (Poindexter et al, 2005), and those…
Ric molecule of a homologous aminotransferase from C. glutamicum (PDB entry 3cq5; Marienhagen et al., 2008), which shares 59 sequence identity with HisC, because the search model. The system Phaser…
F reactive oxygen species (ROS) in endothelial cells by shear flow and involvement of ROS in shear-induced c-fos expression. J Cell Physiol 1998, 175:15662. 20. Godbole AS, Lu X, Guo…
Primers NMG-822 and NMG-823 (Supplementary Table six) and submitted for DNA sequencing. Concurrently, the colonies have been inoculated separately into 1-mL DRM cultures in a 96-deep well plate and grown…
Temozolomide (TMZ)-resistant recurrent GBM cells (22TMZ, 79TMZ) (Fig. 7H,7I). Rembrandt database inspection revealed that overall survival was better in glioma patients with reduced CypB expression in their tumors (Fig. 7J),…
DC3 don't show important departure in the patterns anticipated below neutral evolution in thesummary statistics, either in our sequencing study or the 1000 Genomes project information set (supplementary tables S4…
His drug causes inactivation in the ribonucleotide reductase complicated, effectively depleting the pool of dNTPs and possibly causing fork stalling. Despite the truth that elg1 mutants have enhanced levels of…
Expression (and not just release of intracellular shops), RNA levels wereJID 2014:209 (15 February)Nixon et alFigure 1. Human immunodeficiency virus (HIV) ransgenic (HIV-TG) mice are extra susceptible to vaginal herpes…
Cy. To compare the genome from the SVV BAC to WT SVV we utilized comparative genomic hybridization. CGHanalysis was employed as a cost-effective and correct method to analyze genomic DNA…
Otected Viral DNA (copies/uL)HHV-6AHHV-6BHHV-FIG 5 Production of infectious virions following induction of viral replication by the apoptotic inducer DCPE. Supernatants from the cell lines latently infectedwith HHV-6A, HHV-6B, or HHV-7,…
E routes for enrolment on to neighborhood centre-based activities are likely to address unmet health needs, although the development of new and potentially supportive social networks present regional assets for…
DG induced a fast loss of ATP in MCF-7 cells (data not shown). In contrast, Mito-ChM or Mito-ChMAc alone induced ATP depletion in MCF-7 and MDA-MB231 cells. Interestingly, Mito-ChM didn't…
.Differential effects of slow (EGTA) and rapid (BAPTA) exogenous Ca2+ buffers on VGCCdependent minis. (a, b) Time-course of mEPSC frequency modifications in the course of incubation in BAPTA-AM (a) and…
Intracellular pipette answer containing (in mM) 147 NaCl, 10 HEPES and 10 EGTA. This remedy contained (in mM) 147 NaCl, 10 HEPES, 13 glucose, two KCl, 2 CaCl2 and 1…
Ed flow-induced Nrf2 nuclear translocation (Fig. 4I). These outcomes recommend that XBP1 is crucial for basal and disturbed flow-induced HO-1 expression by way of regulation with the Akt1/Nrf2 pathway within…
Antimicrobial agents hence represent two critically essential objectives that stand to advantage from a clarified molecular description on the biological activities of AmB. In addition, an sophisticated understanding of the…
Ive clinical follow up study of 115 transplanted individuals getting long-term rapamycin remedies failed to show a rise in cardiovascular disease, having said that, there was a trend towards twice…
) is closely correlated with OS. A score of CC-0 indicates no residual peritoneal disease immediately after CRS; CC-1, 2.5 mm of residual disease; CC-2, residual tumor among 2.five mm…
Ow it through the process of reprogramming. In this report, we demonstrate that pluripotent stem cells with the epiblast-like/primed state exhibit a characteristic blue fluorescence in standard media that arises…
8 0.44a 69.12 0.50 1.65 0.36 1.55 0.a a ad0.04 0.08a 0.27 0.035 0.15 0.087 0.24 0.076 0.18 0.10 23.06 0.44a 62.27 0.51 eight.61 0.d b ad0.28 0.073c 0.35 0.034…
. Franceschini FC. Performed the experiments: GG AP S. Franceschini S. Fernicola VS SR. Analyzed the information: GG AP S. Fernicola SR FC. Contributed reagents/materials/analysis tools: AP SR FC. Wrote…
Ght, BMI and CVD threat scores (CRFs and CRFs + fit) had been equivalent in both genders. When the Bonferroni correction aspect for several tests was applied, only those with…
Of 1.2 min. Handle experiment results indicate that the expression of Src FRET biosensor did not perturb the organic FA disassembly procedure, because the mCherry-paxillin intensity at Lam-FAs decreased with…
Y BrdU incorporation, at 48 hours as in comparison to SMC alone or in co-culture with M0 macrophages (Fig. 6A). We examined expression of numerous cytokines previously shown to be…
Teins had been harvested at different time points for assessment by western blot. Our benefits demonstrate ERK1/2 phosphorylation (pERK1/2) was enhanced by Tat exposure starting at 30 min and peaking…
Nclusions in Vitis vinifera L. cell suspension cultures. Planta 2010, 231, 1343360. Terrier, N.; Glissant, D.; Grimplet, J.; Barrieu, F.; Abbal, P.; Couture, C.; Ageorges, A.; Atanassova, R.; Leon, C.;…
Ion was carried out working with M-MLV and cDNA amplification was carried out utilizing SYBR Green Master Mix kit based on the manufacturer's protocol. Target genes have been amplified working…
Ummer MP, Terwel D, Martinez A, Gorji A, Pape HC, Rommelfanger KS, Schroeder JP, Stoll M, Schultze J, Weinshenker D, Heneka MT: Selective loss of noradrenaline exacerbates early cognitive dysfunction…
Induced by 10 M ranolazine quicker than WT channels. Ranolazine binds for the promiscuous drug target hERG Ranolazine can be a potentially promising therapeutic for LQT3 patients due to its…
En effects of Notch-targeting therapies Therapy GSIs DAPT GSI, unspecified DAPT MRK-003, GSI-18 DAPT Tissue AML-derived stem cells Tal1/Lmo2 mouse model of T-ALL Breast cancer cell lines Glioma cell line…
II-E cells is independent on protein phosphatase. IGF-I stimulated cell death of H4-II-E cells overexpressing regucalcin in presence of vanadate , suggesting that impact of IGF-I just isn't mediated through…
Ia, Berkeley, where she was a Damon Runyon-Walter Winchell Chancer Fund Fellow with Prof. Carolyn Bertozzi. She was an Assistant Professor at the University of Michigan until 2010, when she…
Se enhances resistance of mouse principal hepatocytes to acetaminophen toxicity. Exp Biol Med (Maywood) 2006, 231:54552. 17. Wilms H, Sievers J, Rickert U, Rostami-Yazdi M, Mrowietz U, Lucius R: Dimethylfumarate…
, J.; Ward, E.; Forman, D. Worldwide cancer statistics. CA Cancer J. Clin. 2011, 61, 690. Abdellatif, K.R.A.; Belal, A.; Omar, H.A. Style, synthesis and biological evaluation of novel triaryl…
Ctures on behalf of many firms inside the meals and pharmaceutical industry, including some on cereals, milk and milk merchandise, tea, nuts, and nutritional supplements. Tali Sinai and Chaim Yosefy…
Ce capabilities. In the starting of this effort, 5758 IMGT/HLA Database three.five.0 alleles had not been incorporated inside the original CWD catalogue, and weren't considered as candidates for inclusion in…
Version on PubMed Central for supplementary material.AcknowledgementWe thank K. Ma for critical discussions. Analysis reported in this publication was supported by the National Institute of Neurological Problems and Stroke from…
Two IgG-like domains connected by a long linker. The two repeat IgG-like domains are practically identical with an rmsd of 0.59 over 143 aligned C atoms. The protein types a…
Roduction since it contains abundant polysaccharides (Lesiecki et al., 2012). The usage of pectin-rich sources as bioenergy feedstocks will call for saccharification and fermentation methods which are optimized for the…
Population (Young et al., 1993, 2002) having a prevalence of 174Frontiers in Physiology | Integrative PhysiologyOctober 2014 | Volume 5 | Post 418 |Conde et al.Carotid body and metabolic dysfunctionin…
Sts (Fig. S1). To ascertain if Rictor induction by TGF-b is mediated by Akt, we applied the precise Akt inhibitor, Akti (Akt inhibitor VIII/ 124018, Millipore, Billerica, MA). Akti triggered…
F HIV infection/AIDS . HIV clinical trials revealed the magnitude of advantage when using antiretroviral drugs to stop sexual transmission or mother-tochild transmission of HIV-1 , suggesting the new use…
No receptor (3T3) were incubated with DyLightTM 488 labeled clusterin (green) at 4 to enable binding of clusterin towards the receptors. ApoER2 3T3 (D ), VLDLR 3T3 (G ), or…
. Biochem Pharmacol 2009, 78:1083094. 29. Shanmugam MK, Kannaiyan R, Sethi G: Targeting Cell Signaling and Apoptotic Pathways by Dietary Agents: Function within the Prevention and Treatment of Cancer. Nutr…
And wild-type (WT) 129/SvEv mice (Jackson Laboratory, Bar Harbor, ME) have been utilized within the study. Colon tissues had been obtained in the IL-10 KO and WT controls mice at…
-II]),15,105 suggesting an all round survival advantage. The median follow-up period for information reported to date remains reasonably short for either trial (approximately two years), and there are actually certainly…
EGFR degradation happens in sensitive but not resistant cells, and c-cbl-dependent lysosome pathway is accountable for this effect . For the reason that c-cbl was activated by Src to facilitate…
Irrhosis fibrosis nashdx nas ten 26 eight 9 22 six yes yes yessteatosis lobular balloon yesSignificant in HCCNo. of phenotypesyes yes2Reactome15 2211 18yes yes yesyes yes yes2 2growth hormone BioCarta…
Mine . LC3B is really a mammalian homolog of yeast ATG8, and isAutophagy initiationIn mammals, the web-site of origin for autophagosome formation may be the phagophore. The organelles that contributewww.cell-research…
Gly-7, and Lys-8 in B27(309 20). The pretty low RMSD fluctuation of DNAP(21123) soon after the first 50 ns of MD simulation and also the smaller sized RMSF values, relative…
Ease of pre-stored substances in the endothelium to reduce circulating concentrations of pro-inflammatory mediators which include vWF. To test this hypothesis, we treated cultured HUVECs with LC n-3 PUFAs, docosahexaenoic…
Employing ALO AIMs on days 15, 22, 29, and 36 and for motor efficiency making use of FAS on days 17, 24, 31. On day 37, rats had been offered…
On levels are vital for dendritic and axonal compartmentalization and synaptic plasticity. This makesdifferential cell adhesion as a fundamental mechanism of neuronal cell differentiation that controls the finest aspects of…
Tive WD (Trp-Asp) motifs which are conserved domains in ARPC1 protein , have been also identified in the ARPC1 subunit from D. variabilis. Alignments for the remaining subunits, DvARPC1, DvARPC2,…
Or manuscript; out there in PMC 2014 December 01.NIH-PA Author Manuscript NIH-PA Author Manuscript NIH-PA Author ManuscriptJiang et al.Pagerespectively) decreased with age (Fig. 5F). As just before, lipoic acid remedy…
L of Alzheimer's disease). The lipoic acid-mediated boost inside the bioenergetic parameters may well be accounted for when it comes to a rise in mitochondrial density in principal cortical neurons…
He background was subtracted, and the charge state was set to 1. The algorithm identified salt adducts (Na+ and K+), and the protonated molecules + and associated adduct ions have…
Nes 7) induces caspase-3 activation when compared using the control plus DMSO situation (lanes 1) inside the key neurones. Remedy with isoflurane plus dantrolene (lanes 102) induces a lesser degree…
G 23 various components of ESCRT-0/I/II/III and related proteins in HeLa CIITA cells expressing MHC class II indicate a part for only a couple of members of this household (STAM…
Otaxis utilizing the percentage of worms performing isothermal tracking (IT) behavior at 20uC. Around 30 worms from every single remedy at each and every time point have been randomly chosen…
Olume 27 Numbercmr.asm.orgSimonsen et al.FIG 2 Schematic representation of events connected together with the formation of deep cortical white matter lesions in periventricular leukomalacia. GW, gestational weeks. (Adapted from reference…
Ncrease because of tissue hypoxia in iron-deprived mice and rats and because of inhibition of your iron-dependent HIF prolyl hydroxylases in Caco-2 cells treated with deferoxamine (an iron chelator). What's…
Ts from dilution with endogenous (unlabeled) propionyl-CoA, it is unlikely that octanoate stimulates endogenous propionylCoA production as there is a higher competitors totally free CoA, resulting within a smaller pool…
From a thesis submitted by D.S. in partial fulfillment from the needs for the degree of doctor of philosophy inside the graduate school of healthcare sciences, Albert Einstein College of…
Is EC-3 loop conformation may possibly contribute to forming a protected, closed EC surface, as has been reported within the crystal structures of rhodopsin (Li et al., 2004) and the…
He ICP then falls more than several minutes to attain a significantly reduce baseline, but remains greater than normal . The temporary intracranial circulatory arrest promotes hemostasis and contributes to…
Ta-adrenergic receptors . Other such studies indicated that beta-adrenergic signaling can regulate numerous on the cellular processes involved in cancer progression, tumor cell proliferation, extracellular matrix invasion, angiogenesis, matrix metalloproteinase…
Baicalein, as an inhibitor of 12- and 15-lipogenases (Deschamps et al. 2006), reduces basically the level of ROS/RNS in the aortas of manage rats (line two), whereas the effect of…
Ls for various degenerative ailments, which include cardiovascular system illnesses , nerve program illnesses and diabetes , which have obtained significant achievements and shown prospects of wide applicability. There are…
Sistance), pncA (pyrazinamide resistance), gyrA (fluoroquinolone resistance), rrs (kanamycin, amikacin, and capreomycin resistance), tlyA (capreomycin resistance), and eis (promoter area mutations related with kanamycin resistance) (two). MDDR is available by…
Hose undergoing aneurysm treatment and intra/ extracranial stenosis treatment had been therapeutically anticoagulated with an activated clotting time of at the least twice baseline. Patient demographics, process type, and pre-…
Equently, the stain remaining inside the cells was solubilized with 70 ethanol, and the OD620 was determined working with a Tecan Infinite M200 plate reader (Tecan Austria GmbH, Grodig, Austria).…
Oplasm, where it acts to promote pathogen virulence by altering plant metabolism. Alternatively, HopQ1 could initially target host nuclei, exactly where it can be phosphorylated then exported in to the…
Sis EctD protein. The S. alaskensis EctD protein was purified by affinity chromatography and its quaternary structure was then assessed by gel filtration analysis on a HiLoad 16/600 Superdex 200…
O-domains (20-nm diameter) (10, 35), with H-Ras densities above 4,000 molecules/m2. More than this broad array of physiological densities, H-Ras is expected to exist as a mixture of monomers and…
Pression of Cspg5 has been described within the nerve fiber and inner plexiform layer in the course of formation with the retinal synapses . Furthermore, spatiotemporal regulation of Cspg5 has…
Rtic collagen, hyaluronan content, and/or increased attachments in between vascular smooth muscle cells and collagen through improved fibronectin and its receptor, a5b integrin receptor . These having said that don't…
16 E7 oncoprotein. Proc Natl Acad Sci USA 96(4): 1291296. 14. Stet A, et al. (2007) Nuclear translocation on the tumor marker pyruvate kinase M2 induces programmed cell death. Cancer…
Behaviors of HCT116 and HCT116R cells exhibited in vivo inside the tumor atmosphere and investigated the anti-cancer, -metastasis activity of chemopreventive agent (curcumin) and its potentiation effect on commonly utilised…
Has object symmetry (i.e. symmetry along a central axis; Valen, 1962; Klingenberg et al., 2002; Weinberg et al., 2006). In contrast, DA involves structures that happen to be systematically larger…
Ing of GPCRs during illness processes by way of the calpain-dependent regulation of cellular GRK2 levels (Lombardi et al., 2002). In addition, in vitro research have revealed many non-classical signaling…
Nism. The method of fiber development at the membrane surface has been demonstrated to contribute to membrane disruption in some circumstances, while other studies have shown that formation of -structure…
Es alanine, valine, leucine and isoleucine (Fig. two). Within this group, alanine predominates (Table S1). Transformation of 3-phosphoglyceric acid can result in the synthesis in the amino acids serine, glycine…
), USA, Pharmacology Good quality Handle (Precision Testing) program, which performs standardized inter-laboratory testing twice a year16. At UCSD, the decrease limit of quantitation (LLOQ) was 0.047 mcg/mL for atazanavir…
With littermate controls (56). These final results suggest that Trx1 has a protective impact on decreasing oxidative tension inducing failure in T1DM and T2DM. The endogenous Trx1 inhibitor, Txnip, was…
Etes (Jetten et al., 2010). Among these, the deepest branching anammox genus, `Candidatus Scalindua' (hereafter known as Scalindua), would be the only representative identified in all marine environments investigated worldwide…
Lar Medicine (2013) 45, e67; doi:ten.1038/emm.2013.116; published on-line 13 December 2013 Key phrases: 5-HT2A receptor; mesenteric artery; serotonin (5-hydroxytryptamine); voltage-gated K channelINTRODUCTION Serotonin (5-hydroxytryptamine (5-HT)) is often a neurotransmitter that…
E were considerably smaller than broods developed by handle daphnids (Fig. 8D).DiscussionIt has been recognized for decades that the hormone methyl farnesoate plays a lot of significant roles in crustacean…
E resolution to alter its solubility for enlarging its applications to the oil food, cosmetics and pharmaceutical fields. Recently, an erythorbyl fatty acid ester of erythorbyl laurate was obtained for…
Bond inside the MoVI bisoxo complicated is 106 kcal/mol (Table 2). This significant difference in oxo bond strength drives the oxo transfer for the phosphite. In the DMSO reductase reaction,…
He suspensions at varying effector-to-target cell ratios in 96-well plates (final volume, 200 l) and incubated for 4 hours at 37 , then 30 l of supernatant from each and…
Ibitor potently inhibits brain tumor malignancy and development. Anticancer Agents Med Chem. 2010;ten(1):285. Zhang YW, Staal B, Essenburg C, Su Y, Kang L, West R, Kaufman D, Dekoning T, Eagleson…
Ibial enthesis, thus we may possibly suggest that each entheses present a equivalent organization on the collagen fibers. In between uncalcified and calcified fibrocartilage could be observed the tidemark, the…
S adjustments in renal salt handling plus the shifting in the pressure-natriuresis partnership, maintaining blood stress values in the standard variety. As a result, our study strongly suggests that renal…
Containing 10 L FastStart Universal SYBR Green PCR Master (ROX), 0.5 mol of each primer and 1.0 L template (twenty diluted cDNA). RT-qPCR disorders were as follows: 50 , two…
He interface in between environment as well as the body. They're continuously exposed towards the external stimuli and regulatory mechanisms have already been created to avoid a permanent hyper activation…
Ributes towards this difficulty. For health-related students, there is a lack of proof as to how this know-how gap could be addressed.WHAT THIS STUDY ADDSThe identification of regions of practice…
Le effect in arresting EIR with lateral root surface involvement, the classic Cvek (1992) remedy really should be performed. Treatment following serious dental trauma is usually divided to mature and…
Tudied fluorouracil-based regimens in later-line therapies, far more than half from the sufferers received infusedMA et al.TABLE 4 Stages Stage III or IV Recurrent or metastatic Stage III: 11 Stage…
Otted for the indicated proteins. (E) HeLa Flp-In T-Rex KO cells expressing 3x Flag-RNF213WT had been treated with doxycycline for 36 h to induce FlagRNF213WT. Cells were harvested, and lysates…
Uction . Such repression is mediated by a metabolic suppressor encoded by MIG1 gene as well as the co-repressor complex Cyc8-Tup1. The deletion of MIG1 upregulated crtI, crtYB and crtS…
Ng phosphate buffer saline (PBS) pH 7.4. The resultant dispersion was vortexed for about 2 min. The dispersion was allowed to stand at rest for 2 h at area temperature…
Ory effects it exerts on individual microglia. We hope to find out a lot more published investigation on the observable pathways and functional properties that modify just after remedy in…
Repeated dose 90-day oral toxicity study was performed with an a-amylase developed with an intermediate upstream strain inside the very same strain lineage as the strain NZYM-BC. Though the production…
Release from enteric capsules filled with atenolol may be explained by the drug's weak fundamental naturePharmaceutics 2022, 14,7 ofphase from the dissolution test. The dissolution price is fastest below sink…
Dded to the decrease chamber as a chemotactic invasion inducer. Right after 24-48 hours of incubation, cells on the surface in the upper chamber in the Transwell have been wiped…
Ficient to replace chemical and synthetic antiviral agents. With all the progress of microalgae bioengineering technologies, the applications of biological cultures, and genetic engineering and other technologies present a very…
Ectively, had been performed. According to the reference values out there at the laboratory of our hospital, abnormal levels of troponin corresponded to levels 0.014 /L. Multivariate Cox regression models…
At a sizable number of PBP-EVs penetrated through the injured endothelium and were internalized by TECs. Within this context, we additional evaluated the impact of PBP-EVs around the cell cycle…
Reased the concentrations of serum AST and ALT, too because the levels of TC and LDL-C Accordingly, a previous study revealed that exposure to BPA elevated the hepatic TC and…
Igation period, and S. Corvallis and S. Braenderup have been the predominant Salmonella serovars. Many of the clinical isolates of Campylobacter and Salmonella infections in humans most likely originate from…
H of PACL and method of PACL and C_PACL toward CHG as well as other antibiotics (CT: colistin, IPM: imipenem, C_PACL toward CHG along with other antibiotics (CT: colistin, IPM:…
BZ-X810 Keyence fluorescence microscope displaying the intracellular A42 in transfected BV-2 or mouse main microglial cells. The location corresponding to intracellular A42 was traced using a bright-field overlay image, as…
Imilarly, the liver, which does not possess the enzyme Oxct1/SCOT1 to metabolize AcAc-CoA, is capable to produce but not catabolize ketone bodies (Figure 1). Typically, ketone bodies are an option…
Or the Fisher's precise test for categorical information, and the one-way evaluation of variance with Tukey's post hoc tests for age, years in practice, and variety of cancer types treated.…
Rm Abs Norm Abs ND ND Norm Abs Norm Abs ND ND Norm Abs ND NDND ND6m6 months, n = 4 (n = three at six months)31 7.5a 21.eight four.six…
Ilar to many research prior to, we also detected the accumulation of ELIPs upon desiccation; as a result, the accumulation of ELIPs appears to be a common response to drought-induced…
He predictability in the model. Evaluate the randomly creating education sets with 5000 sample repetition, plus the predicted response of every single sample is obtained. A random perturbation of your…
Pe adult zebrafish of both sexes were separated in two tanks (30 L every), in accordance with their gender, at 26 2 C under organic light-dark photoperiods. Fishes were fed…
Ression of thyroid cancer. As miRNAs are vital to stabilize thyroid follicles and hormone production, it really is perceivable that alterations in genes involved in miRNA biogenesis might have repercussions…
BioMed Study InternationalTable 2: The good quality assessment tool for before-after (pre-post) studies with no manage group: scores of integrated studies. 1 2 Y Y Y 3 Y Y Y…
Nalysis of chitosan and chitosan/TiO2 composite membranes. Figure two. FTIR analysis of chitosan and chitosan/TiO2 composite membranes. Table 1. Assignment of relevant IR absorption bands of chitosan and TiO2 .…
In CD38 enzymatic activity major to NAD(P)H depletion and endothelial dysfunction (Reyes et al., 2015; Boslett et al., 2018a). Administration of a potent CD38 inhibitor resulted in reversal of endothelial…
Elected PI3K/AKT and EGF signaling pathways as potential upstream regulators of CHD6 due to the fact PI3K/AKT was prominently presented in both IPA (Fig. 2a) and gene set enrichment analysis…
Le online two March 2022 Keywords and phrases: Depression Adult hippocampal neurogenesis Wnt/b-catenin CrocinPeer overview under responsibility of Cairo University. Corresponding authors at: School of Chinese Medicine, College of Integrated…
C like major chromosomal events are currently present in the MGUS state, added molecular events are necessary for progression from MGUS to MM, and only a minority of MGUS individuals…
Fferent clusters, which had been displayed in distinctive colors. Probable molecular associations were depicted if a distinct keyword had a simultaneous association with DM1 or any identical search phrases by…
That GA is an area of hypopigmentation exactly where choroidal vessels are far more effortlessly visualized because of the degeneration of the retinal pigment epithelium (RPE), followed by dysfunction and…
R accomplished MMR vs. 26 within the resistant group).Table three. Grades of general responses to asciminib taking into account intolerance vs. resistance. CHR, complete hematological response; CCR, total cytogenetic response;…
Ime just after reinforcement finding out improved accuracy by facilitating the retention and collection of the productive movement. These benefits are consistent with prior behavioral findings on uncomplicated motor skills20,21,32,49…
Hina and most of the high-income countries. It appears evident that efforts to increase awareness, guide molecular epidemiological surveillance and carry out systematic screening of B. pertussis constructive samples for…
Cid and 10 ferric chloride FeCl3 (0.1 ) have been added. The results had been expressed as A0.50 s (i.e., concentration producing 0.five absorbance). 2.6.eight. Phenanthroline Assay Phenanthroline assays were…
Logical situation, ROS plays a crucial role in proliferation, differentiation, and apoptosis of a variety of cells, like renal collecting duct cells . Oxidative stress for the duration of different…
D Sci USA. 2013;110:E4362. 38. Liu Y, Kintner DB, Chanana V, Algharabli J, Chen X, Gao Y, et al. Activation of microglia depends on Na+/H+ exchange-mediated H+ homeostasis. J Neurosci.…
Hich is triggered by either extrinsic or intrinsic stimuli (Radak et al., 2017). The intrinsic stimuli for apoptosis are by way of a series of mitochondrial signaling pathways (Yu et…
Ne subsetold animals (Figure three). Similar to 2.3. Assessment on the M1 markers,and Aging on M2 alter the number of CD163 Iron Loading iron loading didn't Hepatic Macrophages ++elevated in…
Rable to inhibition from the paralogous isoform, enolase 2 (ENO2). A preceding perform described the sustained tumor regression activities of a substrate-competitive phosphonate inhibitor of ENO2, 1-hydroxy-2-oxopiperidin-3-yl phosphonate (HEX) (five),…
Usion imaging represent exactly the same group of mice at unique time points. The AA mice also served an additional purpose of becoming a control for the influence of handling…
Urther study of inter- versus intra-hemispheric networks that develop over human gestation warrant additional study. Hemispheric asymmetries are observed for a wide variety of structures beginning inside the second trimester…
Was loaded onto NuPAGE 42 Bis-Tris protein gels (Invitrogen) following the manufacturer's guidelines. CD38 protein was detected by probing the membrane with an anti-CD38 primary polyclonal rabbit antibody (1/1000; ab216343;…
Ofosbuvir +Velpatasvir50 20 50 Concentration one hundred 100 51.21 0.15 9.39 1.76 three.96 0.90 ; -Digoxin rPapp 1 6.09 0.18 6.09 0.18 7.38 1.rPapp, efflux ratio. Statistical evaluation was performed…
Troscopy is also becoming utilized for identication of a `type' of molecular species, however this method has some limitations: SERS spectra might not be simple to interpret, may not be…
-observed resistance to serum bactericidal activity in vitro (11). Isogenic noncapsulated strains and capsule-defective strains are far more susceptible to serum bactericidal activity than wild-type K. pneumoniae strains (12, 13),…
Iceptive threshold to thermal stimuli 8 of 12 investigated, using the Hot Plate test (48 ), and compared with that induced by Prior to drug administration the mice basal thermal…
TEAOH, and 160 mM NMDG-methanesulfonate. Remedy osmolarity was measured and adjusted to 300 mOsm with glucose. Proton pH dependency was studied by eliciting the proton currents using a variable duration…
Various isolates, allowing the speedy monitoring, tracking and tracing of bacterial infections. In recent decades, antimicrobial agents have already been employed often in animal husbandry not simply to treat and…
Utanol fraction (8.04 0.08) whilst the lowest is by an ethyl acetate fraction (7.1 0.21). It shows that all the fractions are within the secure variety at high doses that…
Of CD28, CD16, NKp46, and IL-2, and had reduce eight of 16 protein expressions of CD80, CTLA-4, PD-1, and IL-6.Figure 6. Tumor immune checkpoint molecules and cytokines in Lewis LLC1…
E null hypothesis results in interdependence relationship between foreign equity costs and domestic equity costs. Thirdly, the foreign trade volume has a significant effect on domestic trade volume inside the…
Ents with BRAF V600E mutation . Other BRAF inhibitors, including lifirafenib (BGB-283), BGB-3245, and binimetinib (MEK162), have already been regarded as prospective target therapy options for NSCLC with BRAF mutations.…
Ading towards the improvement of antiproliferative activity of CP338. CP hybrids Ia,b39, II21, and III21 (Figure 1) incorporating N-acylarylhydrazone, arylacetamide, and aryl sulphonyl moieties, respectively at the N-4 position of…
Ints . 2.3. RNA Extraction and Quantification All samples were stored in an Eppendorf tube with Allprotect tissue reagent (Qiagen, Carlsbad, CA, USA) overnight at four C after which at…
Bated at 23 for 30 min. The absorbance at 517 nm was measured applying an Epoch2 microplate spectrophotometer (BioTek, USA). Ascorbic acid (AA) (Duksan) was employed as a constructive manage.…
www.nature.com/scientificreportsOPENReceived: 27 January 2017 Accepted Nuscript Author Manuscript Author Manuscript www.nature.com/scientificreportsOPENReceived: 27 January 2017 Accepted: six November 2017 Published: xx xx xxxxPim-3 as a possible predictor of chemoradiotherapy resistance in…
Ividuals having GS are leaner and healthier, and are for that reason less most likely to contract metabolic illnesses or die prematurely thereof. The metabolism considerably impacts energy turnover on…
D. The supernatants were assayed for TNF- concentrations. Ex vivo PA stimulation of AMs from WT and JNK1-/- mice induced a significantPLOS One particular | DOI:10.1371/journal.pone.0169267 January 6,13 /Pseudomonas aeruginosa…
D.W was employed as a vehicle handle. Saline in D.W was applied as a unfavorable control. Values are presented as the imply normal error with the imply. P0.01 and P0.05,…
Ng endothelial cells, we generated zDCDTR#x02794;WT chimeras. Similar to CD11c+ cell depletion, DT remedy of those chimeras depleted the vast majority of CD11chi cells and partially depleted the MHCIIhi population…
Red generation of full-sized transcripts. If genes in a specific response pathway had been of equivalent sizes, the completion of their mRNAs would be anticipated to occur in the very…
Physiological pH (7.4) utilizing the Henderson-Hasselbalch equation: pKa-pH = log /, where BH and B- are the neutral and ionized (deprotonated) forms, respectively (67). The outcomes showed (Table two) that…
Had been also sensitive to 1-10-phenanthroline. (B) Screen from the effect of pH on proteolytic activity in YNB and DMEM supernatants. 3 efficiently cleaved IQ substrates have been chosen for…
Nts the Thr(P)160 site.Figure 1. Phosphoproteomic identification of PI3K/MAPK pathway nodes. A, scatter plots illustrate peptide phosphorylation changes soon after single inhibition of MAPK or dual inhibition (Combo) of MAPK…
Reviously (Lee et al., 2011). The following cytokine productions had been analyzed: interleukin (IL)-1, IL-1, IL-6, IL-10, granulocyte macrophage colony-stimulating aspect (GM-CSF), granulocyte colony-stimulating issue (G-CSF), macrophage colony-stimulating issue (M-CSF),…
Tions19. Human induced pluripotent stem cells (hiPSCs) possess a terrific deal of guarantee as material for regenerative medicine20,21. Induction of hiPSCs into mesenchymal cells with mesenchymal stem cell (MSC)-like plasticity…
An optimal trade-off amongst prediction errors (false good vs. false unfavorable predictions). Here we describe results from the model in which we observed an equal trade-off between each errors as…
A SOX10 mutants again demonstrated a SOX10 degradation plateau near 50 . These information recommend that SOX10 protein regulation is complex and may perhaps involve feedback mechanisms for protein regulation.…
Proteins. The Sumo3x SOX10 mutant was used as a post-translational modification handle, since it is known to express inside the nucleus regardless of mutations in all three sumoylation internet sites.…
Resulting concentration with measured concentrations inside a national survey. Thispermits a rough estimation in the relative contribution of inhalation and dermal uptake to total phthalate uptake from all pathways. Methods…
Ypercholesterolemia. Statins inhibit 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase, an early and rate-limiting enzyme of cholesterol synthesis, thereby preventing the conversion of HMGCoA to mevalonate, and lowering the levels of mevalonate…
Lamide gel electrophoresis, and transferred onto a nitrocellulose membrane (Amersham Biosciences, Piscataway, NJ). Subsequent, immunoblot evaluation was performed working with anti-MMP-9 antibody (Millipore, Billerica, MA), also as anti-ZO-1 and anti-occludin…
Nign proliferation of mucosal surfaces caused mostly by the HPV subtypes 13 and 32 . It typically presents as multifocal, verrucous papules with the labial, lingual, and buccal mucosa which…
Static disease. Pipavath et al14 have described the high-resolution CT findings, including miliary nodularity, consolidation, ground glass and focal cystic abnormalities. Sharma concluded from his study that CT is superior…
Pioid for optimal analgesia. The sufferers had to be opioid-experienced, defined by taking a every day opioid dose for 30 days before screening, excluding tramadol and/or ER morphine goods. The…
Significant conformations, generally not all biologically relevant conformations might be crystallized. Nuclear magnetic resonance (NMR) spectroscopy, the premier technique to study protein dynamics at atomic detail, suffers from a size…
Motes early tumor dissemination by means of complexing with activated 1 integrin and induction of FAK/PI3K/Akt motility signaling. Oncogene 33:25568. 17. Spassov DS, Baehner FL, Wong CH, McDonough S, Moasser…
On StACRThr(P)Tyr(P) pulldown because it incorporates proteins that interact with APP inside a Thr(P)668- and Tyr(P)682-dependent manner. The reaction was immunoprecipitated using the -FLAG M2-agarose beads, and proteins have been…
Te EGFR expression, with a magnitude of induction related to that for TSH (54). The expression of EGFR1 protein is drastically upregulated in PDTC and ATC, and absent or slight…
Ction. Our studies show that inhibiting the autophosphorylation of EGFR plays a crucial purpose during the anti-breast cancer efficacy of TM208 and other dithiocarbamates. Moreover, we investigated the pharmacokinetic traits…
S not substantially larger in presymptomatic comparedFigureCSF measurementsScatterplots of CSF measurements of Ab40 (A), Ab42 (B), total tau (t-tau; C), and phosphorylated tau181 (p-tau181; D). Ab 5 b-amyloid; HCHWA-D five…
D establish its physiological relevance using a mouse model in which the status of Yap/Taz is not changed. To this finish, we took benefit of an current liver-specific Sav1-knockout mouse…
7 analogous towards the Cl--free ferric KpCld. Within the two former situations, the aqua complicated is thermodynamically favored more than the 5cHS complicated that dominates the speciation of WT DaCld…
Concurrent chemoradiation; OS, general survival; PFS, progression-free survival; LC, nearby handle; RC, regional handle; DMFS, distant metastasis-free survival. a) Log-rank test.0.0.Values are presented as median (variety) or variety of sufferers…
Actors signaling pathways, proteins regulating synaptic transmission, and actin microfilament through the very first day on the studying curve; (two) transcription and translation machinery, protein trafficking, enhancement of metabolic activity,…
Therwise stay quiescent. Not surprisingly, several of your genes we've got uncovered by means of our analyses are themselves orthologs of tumor suppressors or gene solutions which have been implicated…
Ademy of Sciences and grown in F12 and RPMI 1640 media, respectively, supplemented with ten fetal bovine serum (Gibco, Carlsbad, CA, USA) inside a humidified incubator (Thermo Scientific, Waltham, MA,…
Rapid metabolism of CORT to biologically inactive water-soluble types in the liver, and subsequent excretion via the urine (Table 1). CORT can also be metabolized inside different target cells by…
Combination (adjuvant remedy) e.g. external beam radiation therapy (EBRT) for margin constructive disease or seminal vesicle invasion or hormonal therapy (HT) for e.g. in case of constructive lymph node.7 It…
Ssion (Fig 6C, appropriate panel). These findings clearly indicate that HHT and HT inhibit 2'3'-cGAMP-induced expression of ISGs.PLOS One particular | https://doi.org/10.1371/journal.pone.0182701 August three,8 /Cephalotaxus ester alkaloids inhibit the STING…
Es). Mice have been sacrificed by CO2 then perfused slowly by means of the ascending aorta with 30 ml PBS and EDTA (Thermo Fisherliver Mononuclear cell isolationFrontiers in Immunology |…
Ession of cytochrome c oxidase subunit-IV (COX IV; a part of complex IV) and cytochrome c within the gastrocnemius muscle of mice immediately after one particular session of treadmill workout…
Isolated from bone marrow of C57BL/6 mice had been transduced with manage (MIG) or RE retrovirus. The subsequent day, cells had been washed and treated with ten ng/mL recombinant murine…
R in resolution orAuthor Manuscript Author Manuscript Author Manuscript Author ManuscriptJ Control Release. Author manuscript; accessible in PMC 2016 June 28.Fan et al.PageDOTAP-HA NPs via intranasal administration on days 0…
/3 expression. (A) Astrocytes were serum-starved (0 FBS inside the DMEM medium) for one overnight (12 h) before the IFN stimulation. Western blot detected the downstream signaling of IFN in…
Upported by Amgen GmbH. MS, MI, and TS are Amgen staff and shareholders. EP was an Amgen employee and shareholder in the time of conducting this study and manuscript preparation.…
(1) 11.750 (3) Wald 2 (df) eight.228 (3) 11.047 (three) Wald two (df) 0.004 (1) 0.004 (1) 0.004 (1) 0.004 (1) P 0.920 0.959 0.008 P 0.042 0.011 P 0.949…
Agments cleavage in GSCs. All GSCs exhibited disruption of neurosphere morphology and structure, cell shrinkage and to some extent lysis of cells with cellular debris evoking necrotic cell death. A…
Of why human PSC are so sensitive to external cues could enable to improve a large-scale in vitro expansion of PSC with optimized cell culture circumstances, the generation of a…
Cells, which was not seen in injured TLR4-/- carotids (Figure IV within the online-only Information Supplement). To establish if TLR4 expression on macrophages plays an critical part in IH, we…
Magnitudes of desiccation in soil: a test on the osmolyte accumulation hypothesis. Soil Biol Biochem 57:644sirtuininhibitor53. doi:10.1016/j.soilbio.2012.08.014 Walker AW, Sanderson JD, Churcher C, Parkes GC, Hudspith BN, Rayment N, Brostoff…
Or glandular structures, while the diffuse-type GC contains infiltrating neoplastic cells and undifferentiated or poorly-differentiated glandular structures. The two subtypes may also differ in clinical parameters, as individuals with diffuse-type…
Al information suggest not simply that the YAP and Hippo signaling pathways culminate in an Mcl-1-regulated tumor survival pathway but also that nuclear YAP expression may well be a biomarker…
. Crespi EJ, Williams TD, Jessop TS, Delahanty B (2013) Life history as well as the ecology of tension: how do glucocorticoid hormones influence life-history variation in animals Funct Ecol…
And grouped into six clades (Fig. 5). Ourresults are related to the discovering that six groups of PGs were present in L. lineolaris (Showmaker et al. 2016) and within a.…
Ng exposure to simazine for (p 0.05). simazine for 48 h compared together with the controls48 h compared using the controls (p 0.05).two.three. Effects of Simazine on Protein Expression in…
O0.01) along with a important good association involving E-cadherin and PR (r = 0.240, Po0.05) were observed in EC. Similarly, significant optimistic correlations were observed between ER and PR (r…
Echanisms could play a function, and point towards a number of pathways that might be involved. A number of pathways related to T-cell function were altered by maternal smoking. GFI1,…
E 2: Pharmacologically inhibiting GCS induces ceramide accumulation in VNR-treated A549 and AS2 cells.Immunostaining followed by flow cytometric evaluation, displaying the levels of ceramide A. and glucosylceramide (Glu-Ceramide) B. in…
Eld (imply of 16 higher energy fields) 00. Measurements had been performed by three blinded, independent observers for four manage and four treated tumors.The data are presented because the imply…
Waiver (://creativecommons.org/publicdomain/zero/1.0/) applies for the information made offered in this short article, unless otherwise stated.Tocci et al. Clinical Hypertension (2017) 23:Web page two ofof comorbidities, for instance CVD, may perhaps…
Analysis, P o0.05. (c) (i) CNL suppresses the activity of PKC. JVM-3 cells were treated with 40 M ghost liposomes or CNL for indicated time periods and western blotting was…
Yl-2-deoxyguanosine (eight) -2-deoxyguanosine 7 (292 mg, 1.1 mmol) was evaporated 3 instances with anhydrous pyridine. The residue was suspended in 10 mL of dry pyridine below argon. Chlorotrimethylsilane (1.195 g,…
Assembly market. He had half-a-pack each day smoking habit. He reported that his eye had been exposed to chemicals as a result of car or truck battery explosion and had…
Y be resulting from the enhanced MDSC and T-regs localizing at the periphery which thwarts CD8+ tumor penetration. To confirm the immunofluorescent final results single tumor cell suspensions had been…
Lycrystalline, the resulting grown semiconductor structures on major are typically going to be also amorphous or polycrystalline. On the other hand, such problem can be solved by using graphene sheets…
G-code, spindle rotation direction, coolant condition, and all the aforementioned parameters. The live update function ensures key information like present tool coordinate, MRR, and cutter depth engagement continuously changes to…
, significantly attenuated promoter activity induced by scriptaid in HPAECs (Figure 6E). The same effect was observed using a plasmid bearing a deleted Sp1/Sp3 binding internet site. Also, we analyzed…
E spatial resolutions of AOD derived from MODIS and MISR are 10 and 17.6 km, respectively. Although GASP includes a spatial resolution of four km, the AOD retrievals are significantly…
Ar SP resistance markers was determined in asymptomatic and symptomatic malaria-infected pregnant girls five years just after the introduction of IPTp with SP in Burkina Faso.PLOS A single | DOI:10.1371/journal.pone.0137440…
Ed by an increase in many lyso-PC (lysolecithin) and lyso-PE species.Ed by a rise in numerous lyso-PC (lysolecithin) and lyso-PE species. The levels of PG (18:1/18:1 and 18:1/18:2) increased further…
Ase at early time points, followed by rising amounts with increasedAse at early time points, followed by growing amounts with improved irradiation. For any point of comparison, we also loaded…
Investigation unit and blood collection for drug quantification commenced immediately prior toAnalysis unit and blood collection for drug quantification commenced straight away just before (within ten min) administration in the…
Out of 10 relevant indicators and symptoms and ordinarily requiring intervention; alsoOut of 10 relevant indicators and symptoms and usually requiring intervention; also depending on the Aasuri, Venkata and Kumar6…
At each and every survey place. Enrolled participants have been encouraged to inform theirAt each survey location. Enrolled participants had been encouraged to inform their peers about the study. Folks…
Mortality of hospital survivors did not differ involving ICU and nonICUMortality of hospital survivors didn't differ amongst ICU and nonICU groups (18.six and 20.4 , respectively, p = 0.36). Furthermore,…
Ntrolled inside the identical HSPG-regulated way. We are going to investigate this possibility.Ntrolled in the identical HSPG-regulated way. We are going to investigate this possibility.Cloning and expression of recombinant proteins.…
T uniformly fatal malignancy characterized by the pathognomonic histologic feature ofT uniformly fatal malignancy characterized by the pathognomonic histologic function of a profound desmoplastic stroma. The PDA stroma, which generally…
Nonuclear cells. (A) Bone marrow mononuclearcells have been isolated from healthful individualsNonuclear cells. (A) Bone marrow mononuclearcells were isolated from wholesome men and women (regular bone marrow; NBM) or AML…
N TWEAK/TNFSF12 Protein Accession residents who have been cognitively intact. Moreover, residents who had aN residents who were cognitively intact. In addition, residents who had a diagnosis of Alzheimer's illness…
Hree years. Followup consisted of imaging, physical examination, endoscopic examinations, andHree years. Followup consisted of imaging, physical examination, endoscopic examinations, and laboratory tests. In case of suspicious illness progression or…
Orrelation among aldosterone levels and liver attenuation. Each and every doubling of aldosteroneOrrelation amongst aldosterone levels and liver attenuation. Every doubling of aldosterone was connected with 1.08 Hounsfield unit decrease…
Entration-dependent. The constitutive isoforms eNOS and nNOS are tightly regulated byEntration-dependent. The constitutive isoforms eNOS and nNOS are tightly regulated by Ca2+/calmodulin, and produce low flux (pM) NO more than…
His suggests a reduce driving force for ligands to bind toHis suggests a reduce driving force for ligands to bind for the d-site. Since the d-site is accessible with no…
1q. No intramembranous deposits were present, vibrant C3 staining was absent1q. No intramembranous deposits have been present, bright C3 staining was absent, and immunofluorescence microscopy revealed staining for each kappa…
Cells in non-human primates (Extended Data Fig. 5i, j). Consistently, theCells in non-human primates (Extended Information Fig. 5i, j). Regularly, the kinetics of infection was distinct among the two ZIKV…
three internet site, resulting in transcription of c-FOS. JNK also phosphorylates and activates3 website, resulting in transcription of c-FOS. JNK also phosphorylates and activates c-JUN, which complexes with c-FOS to…
1 overexpression was achieved by stably transfecting KMCH cells having a plasmid1 overexpression was accomplished by stably transfecting KMCH cells with a plasmid encoding the S peptide-tagged Mcl-1 as described…
Nes, like REF52 or MDCK, as well as principal cellNes, like REF52 or MDCK, at the same time as principal cell lines, cancerous cells and/ or stem cells may also…
Ght/dark cycles. Meals and water have been out there ad libitum, exceptGht/dark cycles. Food and water were readily available ad libitum, except as noted under for certain experiments. Ethical therapy…
Atory ailments. This method has verified beneficial in understanding lung dysfunctionAtory diseases. This strategy has established helpful in understanding lung dysfunction and host responses inside the mouse and cotton rat…
Ched throughout a preset time frame. As a result, a plot of yourChed for the duration of a preset time frame. As a result, a plot in the analysis time…
Egulation of oxidative Mesothelin Protein Species strain. The effects of scriptaid might have broadEgulation of oxidative strain. The effects of scriptaid could have broad, pleiotropic effects. By way of example,…
As skewed in environments using a certain carbohydrate supply. In aquaticAs skewed in environments with a precise carbohydrate supply. In aquatic environments and the human mouth, the relative frequencies of…
L translation occurs as cells recover from injury. Having said that, in neuronsL translation occurs as cells recover from injury. Nevertheless, in neurons fated to die by I/R, selective translation…
H DTT at alkaline pH values. The presence of a detectableH DTT at alkaline pH values. The presence of a N-Cadherin, Human (699a.a, HEK293, His) detectable inactive oxidized type of…
Uininhibitor G') due to the low volume fraction of your dispersedUininhibitor G') as a result of the low volume fraction in the Semaphorin-3F/SEMA3F Protein Purity & Documentation dispersed phase. The…
Notypes in autoimmune issues . Interestingly, Cl-amidine remedy has also been shownNotypes in autoimmune issues . Interestingly, Cl-amidine therapy has also been shown to possess an impact on dendritic cell…
Ent in the manuscript have been disclosed.Pelvic floor dysfunction isEnt from the manuscript have already been disclosed.Pelvic floor dysfunction can be a prevalent disabling condition with suboptimal treatment. Girls with…
Xperiment was terminated.Induction in the Pancreatic PDX1+ ProgenitorsTo generate GutXperiment was terminated.Induction of the Pancreatic PDX1+ ProgenitorsTo generate Gut Tube Endoderm (GTE) we induced H1 ES-derived DE cells with KGF…
N) (Sigma-Aldrich). Ba/F3 was obtained from DMSZ and grown inN) (Sigma-Aldrich). Ba/F3 was obtained from DMSZ and grown in RPMI supplemented with 10 (v/v) FBS (Gibco) and 1sirtuininhibitor ng/ml recombinant…
Study was to characterize the diagnostic functions of HCL-v that distinguishStudy was to characterize the diagnostic features of HCL-v that distinguish it from HCL and SMZL utilizing our exclusive and…
Enhanced proliferation of tumor cells. To assess the resultant tumors forEnhanced proliferation of tumor cells. To assess the resultant tumors for the presence of DsRed-labeled CAFs and CA-MSCs, we performed…
ITD four.0 0.three four.six 0.7 FDC.P1/WT + GM five.1 0.two 5.four 0.0 FDC.P1/WT + FL 2.7 0.3^^ 3.1 0.3^ MV4-ITD 4.0 0.3 four.six 0.7 FDC.P1/WT + GM 5.1 0.2 5.four…
Ene UHRF1 gene-+p16INK4A geneCell development and metastasisInhibition ofEne UHRF1 gene-+p16INK4A geneCell growth and metastasisInhibition of cell development and metastasisFig. 3 Part of CD47/NF-B pathway in UHRF1 regulation. a. CD47 activation…
Und that temozolomide at three mg/kg/day for 4-5 days plusUnd that temozolomide at three mg/kg/day for 4-5 days plus talazoparib at 0.25-0.33 mg/kg/day for 4-5 days might be tolerated in…
IGA grading scores for the erythema among the two sides had beenIGA grading scores for the erythema between the two sides had been Uteroglobin/SCGB1A1 Protein web observed two(P D 0.005,Z…
Further preliminary insights. On the other hand, na e unadjusted comparisons of outcomes fromAdditional preliminary insights. On the other hand, na e unadjusted comparisons of outcomes from distinctive sources are…
Ormoxic and hypoxic values.cant improve in pHi in PASMCs fromOrmoxic and hypoxic values.cant boost in pHi in PASMCs from each normoxic and Carboxylesterase 1 Protein site chronically hypoxic rats. Though…
He variety of animals in both groups. The stratified evaluation ofHe variety of animals in each groups. The stratified evaluation of total and neutralizing anti-GP antibodies based on the outcome…
GG antibody (#7076; Cell Signaling Technologies, Inc., Danvers, MA, USA; dilution, 1:2,000) atGG antibody (#7076; Cell Signaling Technologies, Inc., Danvers, MA, USA; dilution, 1:2,000) at room temperature for 45 min).…
.975 Grouping 1.711 1.317 1.688 Continual -0.241 1.099 0.048 df Sig. Exp (B) 1 0.160 0.000 1 0.194 5.534 1 0.826 0.medulla oblongata, sciatic nerve.975 Grouping 1.711 1.317 1.688 Constant…
-FOLR1 Protein manufacturer sterilized things or sterilize them prior use. NOTE: This piece can-sterilized items or sterilize them prior use. NOTE: This piece is often simply fabricated within the lab.…
That this aspect is often a particular molecule expressed in proliferating hemangiomaThat this issue is really a distinct molecule expressed in proliferating Protease Inhibitor Cocktail custom synthesis hemangioma endothelial cells.…
Suitable for technical assistance with quantitative PCR assays. Sources of Funding.Proper for technical assistance with quantitative PCR assays. Sources of Funding. This perform was supported by NIH grants R01HL43174 (to…
Ession in human mammary epithelial (HME) cells, we necessary to stopEssion in human mammary epithelial (HME) cells, we necessary to prevent apoptosisFig. 1. TLR4 is expected for EGF-induced NFkB activation…
Nded by a grant from Johnson and Johnson, New Brunswick, NJNded by a grant from Johnson and Johnson, New Brunswick, NJ, USA.DisclosureThe authors report no conflicts of interest within this…
Have been grown in methylcellulosemedium for 7 days within the presence of AALWere grown in methylcellulosemedium for 7 days within the presence of AAL(S) Sorafenib, CEP701, PKC412 or Sunitinib. Columns,…
251 exerted no impact. This was readily clear in the hypnogram (Fig.251 exerted no impact. This was readily clear from the hypnogram (Fig. 4a), but in addition in the time…
Ychological symptoms in comparison to guys. The absence of a gender effectYchological symptoms in comparison with males. The absence of a gender impact on symptom class could be due to…
Demand (Cannell and Thornley, 2000). Using basic chemical and STUB1 Protein web substrate treatment options ofDemand (Cannell and Thornley, 2000). Working with very simple chemical and substrate therapies of leaf…
ShRNA tumors and CA-MSC expressing manage shRNA tumors to decide ifShRNA tumors and CA-MSC expressing handle shRNA tumors to figure out if there had been variations within the presence of…
Had been grown in methylcellulosemedium for 7 days within the presence of AALWere grown in methylcellulosemedium for 7 days inside the presence of AAL(S) Sorafenib, CEP701, PKC412 or Sunitinib. Columns,…
Spirosis happen inside the tropics and it's tough to distinguish malaria from these illnesses on clinical grounds alone. Haematological modifications connected with malarial infection, for example haemoglobin, packed cell volume,…
L, the amount of cells (cfu mL-1 ) was BDNF Protein manufacturer determined by plate counting on LG agar. Nitrogenase activity was estimated by the acetylene reduction assay. Bacterial cultures…
Lacing G7, V4, or E10. In contrast, replacement of the arginineLacing G7, V4, or E10. In contrast, replacement of the arginine 9 (R9) with 17 out in the 19 amino…
G a BrdU Flow Kit (BD Pharmingen) in accordance with all theG a BrdU Flow Kit (BD Pharmingen) in accordance together with the manufacturer's instructions. Briefly, mice have been i.p.…
N on each and every side, using the common labeled magnitude scale (gLMS; one particular for each side and time point). The Subjects had been offered a sheet a paper…
Entation points towards the importance of preserving the health on the axonal compartment. Though it remains to be observed irrespective of whether other PD toxin models, for instance paraquat or…
Portance not only for far better understanding from the disease pathogenesis but also for the improvement of novel therapeutic approaches targeting cytokines, signal transduction pathways and abnormal cellular interplay. In…
Tropins and serpins . These peptides have already been created by HMGB1/HMG-1, Human combining experimentalTropins and serpins . These peptides have been created by combining experimental and computational approaches and…
Ubbled with 95 O25 CO2). The chamber was continuously perfused (1.five mlmin) withUbbled with 95 O25 CO2). The chamber was continuously perfused (1.five mlmin) with ACSF using the temperature held…
Lation and artificial vagina . Having said that, high proportion of ejaculates obtained by way of rectal massage represented a sperm-rich fraction with minimal seminal SARS-CoV-2 3CLpro/3C-like protease plasma contribution…
L over ejaculation and satisfaction with sexual intercourse.20 Dapoxetine can be a novel SSRI that is certainly stereochemically related to numerous other described SSRIs.13 Pharmacological studies have shown dapoxetine to…
He cat gene, conferring chloramphenicol resistance. Promoters of various strengths had been discovered, lots of of which had been repressed inside the presence of the tetracycline repressor (TetR) and promoted…
Nificantly connected to SCZ signs and symptoms (specifically before GSR), an result thatNEUROSCIENCEreplicatedNificantly associated to SCZ signs and symptoms (particularly prior to GSR), an result thatNEUROSCIENCEreplicated across samples, so unlikely…
R mediating these effects and promising candidates are pannexin (PANX) hemichannelsR mediating these effects and promising candidates are pannexin (PANX) hemichannels (in particular PANX1), the progressive ankylosis protein homolog ANKH…
Eins and blood stress induced by soy protein is of smaller and questionable clinical significance, consumption of soy protein-rich foods may indirectly decrease CVD risk if it replaces animal merchandise…
Treated with raloxifene or PBS have been examined employing high-energy xray scattering at Sector 1 on the Advance Photon Source (APS) at REG-3 alpha/REG3A Protein web Argonne National Laboratory (Argonne,…
Nt. Liver IL-1and i B was also measured two hr postNt. Liver IL-1and i B was also measured two hr post remedy as an indicator of peripheral inflammatory response (Fig.…
Ted an antibody particularly recognizing the K5-acetylated LDH-A. The specificityTed an antibody especially recognizing the K5-acetylated LDH-A. The specificity of your anti-acetyl-LDH-A (K5) antibody was verified as it recognized the…
Sis identified a number of determinants of inherent resistance which are upstream of your targeted MEK. These determinants incorporate up-regulation of option oncogenic development aspect signaling pathways (e.g. FGF, NGF/BDNF,…
Et light. Microglobulin was used because the housekeeping gene. A one hundred base pair (bp) DNA ladder was loaded to let PCR solution size identification. The gel was subjected to…
T altered the distance amongst the TT and JSR membranes. Ca2?spark fidelity (Fig. four A),rate (Fig. four B), and leak (Fig. four C) decreased steeply as the TT-JSR separation increased…
Ntly enhanced by two PNU-120596 (solid vs. dashed linesNtly enhanced by 2 PNU-120596 (solid vs. dashed lines, Fig. 1G) from IC50(-PNU)=42.7 (Hill slope, 0.98) with out PNU-120596 to IC50(PNU)=12.2 (Hill…
D to 0 . To the mixture at 0 was added 1 mL MeOH andD to 0 . To the mixture at 0 was added 1 mL MeOH and NaBH4…
Illetta, M.G.; Marfisi, R.; Levantesi, G.; Boccanelli, A.; Chieffo, C.; Franzosi, M.; Geraci, E.; Maggioni, A.P.; Nicolosi, G.; Schweiger, C.; et al. Coffee consumption and danger of cardiovascular events just…
Articular cartilage). Scoring was performed by two blinded investigators, plus the imply of each scores was calculated.Quantitative real-time polymerase chain reaction (qRT-PCR)The murine macrophage cell line RAW 264.7 (generously provided…
Restriction additional readily than some others,38 numerous individuals are still noncompliant with this diet due to the unpalatability of food. For that reason, it is important for a dietitian to…
In which prognostic potential was superior to those of IL-6 andIn which prognostic potential was superior to those of IL-6 and APACHEII score. Zhang et al. recommended that serum sTREM-1…
Instantly followed by LPS (ten..gkg, i.p.). Hippocampus was collected forQuickly followed by LPS (10..gkg, i.p.). Hippocampus was collected for inflammatory marker evaluation 1 h, 2 h, or 4 h immediately…
D for 30 minutes then released to induce AMI (Fig. 1). Inside the sham groups, exactly the same operation was performed with no LAD occlusion. The heart was then returned…
By the positioning of two DMXAA in the Peroxiredoxin-2/PRDX2 Protein Accession binding pocket and the formation of your four-stranded, antiparallel sheet lid over the bound ligands (Figure 3F). The crystal…
E final results (Fig. four) showed that the magnitude of antibody response was time dependent with the rVCG-Pmp18D vaccine displaying an immunogenic benefit. Normally rVCG-Pmp18D-immunized mice created substantially greater (P…
Ry antifungal prophylaxis. As several confounding variables may possibly influence the threatRy antifungal prophylaxis. As many confounding variables may influence the danger for breakthrough IFI independently on the kind of…
Igration is as a consequence of its reduced catalytic activity, we measured pyruvateIgration is as a result of its decreased catalytic activity, we measured pyruvate and lactate concentration in LDH-A…
Uman agingCorresponding author: Mohammad Abdollahi. CD276/B7-H3 Protein Accession Division of Toxicology, Division of Toxicology and Pharmacology, Faculty of Pharmacy and Pharmaceutical Sciences Investigation Center, Tehran University of Medical Sciences, Keshavarz…
Ed: 01 SeptemberHeat shock proteins: uphill-downhill exercisestress that unique forms of physical exercise may cause; and b) lack of literature information about the impact of distinct varieties of muscle contractions…
Etime is usually a principal restriction of hyperpolarized NMR probes, the reporter moiety will probably be chosen to supply an atomic web page using a hyperpolarization lifetime that's so long…
Depletion IL-8/CXCL8 Protein Storage & Stability accelerates subsequent maturation of recovered SVs. The time for you to peakDepletion accelerates subsequent maturation of recovered SVs. The time for you to peak…
Ails (Sigma). Cellular debris was removed by centrifugation at 13,000 g forAils (Sigma). Cellular debris was removed by centrifugation at 13,000 g for 5 min at 4 , andjvi.asm.orgJournal of…
H Council (EPSRC, GR/S82053/02, fellowship to G.R., consumable support to R.R., J.A.B.L.), the University of Strathclyde Principal's Fund (fellowship to G.R.) and WestCHEM (studentship to J.A.B.L.). We also thank the…
Cted from heart making use of the DNeasy Blood Tissue Kit (Qiagen). We assessed the relative heart telomere length using quantitative PCR, by measuring for each Carbonic Anhydrase 2 Protein…
D information from cultured human or mouse BECs, and deemed expression inside the prime 25 of genes as indicating substantial EC expression. We also took benefit of Immgen consortium datasets…
Toms in Parkinson's illness, discovered reductions in daytime somnolence andToms in Parkinson's illness, located reductions in daytime somnolence and enhanced worldwide cognition as assessed by the Mini-Mental State Examination, but…
D occulted type two diabetes in the non-overweight group. Moreover, the effectD occulted sort 2 diabetes inside the non-overweight group. Moreover, the impact of CPAP IFN-alpha 1/IFNA1 Protein Formulation therapy…
Arthritic joint destruction,28 we hypothesised that early intra-articular intervention with NBQX (AMPA/KA GluR antagonist) would decrease pain, inflammation and pathology in inflammatory arthritis. The antigen-induced arthritis (AIA) rat model was…
Ygen is beneficial, it really is most likely that it improves OSA by minimizing the sensitivity with the ventilatory control method (i.e. by decreasing LG) (Wellman et al. 2008; Xie…
Ffective Disorders and Schizophrenia for Neurofilament light polypeptide/NEFL Protein Source School-Aged Children-Present and Lifetime Version--Behavioral Component (Kaufman et al. 1997). At visits 2 and three, subjects with ADHD + D…
Allowed to drink water ad libitum. Long-term medicines were discontinued atAllowed to drink water ad libitum. Long-term medicines have been discontinued at the very least 5 half-life periods before the…
E critical for signal transduction. The function of GPCRoligomerization in signalingE essential for signal transduction. The part of GPCRoligomerization in signaling isn't well characterized, though experimental and theoretical data have…
Stically considerable, with OR 0.51 (95 CI 0.23, 1.09), p = 0.08. In multivariate evaluation, there was a considerable reduction in AMD progression within the simvastatin group in FGFR1 Purity…
Ional Resource Center, a NCRR-NIH funded strain repository, and were donated to the MMRRC by the NINDS funded GENSAT BAC transgenic project. B6;129S6-Pclotm2Sud/J mice were bought from Jackson Laboratory. Animals…
Ry supplementation of LC-3PUFA, there is a necessity to develop robust, valid biomarkers of your physiological effects and disease dangers associated with LC-3PUFA intakes. Valid biomarkers in relevant eukaryotic tissues…
Nd the N-terminal are shown in Figure 1. The cytoplasmic region consistsNd the N-terminal are shown in Figure 1. The cytoplasmic area consists of greater than ten sub-domains which can…
Ans of six distinct measure points of 3 independent experiments asAns of six distinct measure points of 3 independent experiments as % of controls SEM. Significances have been calculated with…
E normally distributed. PTH was log-transformed provided the skewed distribution. We then utilised restricted cubic splines to model the association in between ACR and PCR with every outcome, adjusting for…
Butyrate and acetoacetate) grow to be a vital power substrate and their transport in to the brain is essential . The endothelial cells of your blood vessels inside the brain…
And GABAA receptors, to regulate cell surface levels or Aurora B Inhibitor Gene ID functional properties. Certainly, we deliver biochemical evidence in assistance of compartmental RCAN1/ CaN signaling (Fig. two).…
Tropins and serpins . These peptides have already been developed by combining experimentalTropins and serpins . These peptides happen to be created by combining experimental and computational approaches and a…
Ing methanol. Finally, the green coloured solution was obtained by vacuumIng methanol. Finally, the green coloured item was obtained by GLUT3 site vacuum filtration and washed several occasions with double…
ESNP locationPCR amplification primer sequence (5' ?3') aGccatcGat aGtcGaaacG taGGcacGaat ttGcttGaa tccaaGcGta tGctcaaGaa GcacaataGc GaGatGGtca taatcctGGcG atGaGatcc tttGccaaGc tcctccatac GaacctcGca tGGttGaGat aGGGcacttG GttccaGata GctcatcaGG cttttGGaaG GcacaaGcca cccactattt GctcatcaGG cttttGGaaG GcacaaGcca…
N the anticodon region , and heterogeneity with the peptidyl-tRNA made use of for data collection.Int. J. Mol. Sci. 2013,Figure 2. Model of Pth1:peptidyl-tRNA Complicated. The all round shape in…
Ssion of scavenger receptors, for example raphy CBP/p300 Inhibitor Biological Activity applied to separate the LDL subfractions (Fig. 5A) showed CD36, and Toll-like receptors (TLRs), for example TLR-4.18 three peaks…
Accountable applications such as sensors, optical, electronic, magnetic, catalytic and detectionAccountable applications including sensors, optical, electronic, magnetic, catalytic and detection of biological molecules . It is actually a versatile functional…
H they inhibit. The transition states of carboxylesters are tetrahedral, thoughH they inhibit. The transition states of carboxylesters are tetrahedral, while these of OP are pentavalent. Accommodation of your several…
Irst TRPV review genome-wide, single-base resolution maps of methylated cytosines within a mammalian genome from human embryonic stem cells and fetal fibroblasts. The entire analysis took about roughly five days,…
RORγ Agonist Purity & Documentation Arable (405 cM and 228 cM within the two parental maps vs. 480 cM and 276 cM in the maps obtained right here, Table 1).…
Ntage of total fatty acids utilizing theoretical relative response aspects described by Wolff et al., (Table 3). The cis-9, trans-11 CLA content material in HF-Cb and HFCLAb diets was calculated…
Isedronate (RIS) as well as for alendronate (ALN) that therapy ofIsedronate (RIS) also as for alendronate (ALN) that treatment of cells led to the accumulation of isopentenyl pyrophosphate (IPP) and…
Utilizing effector CD4 T cells prepared from cLNs to examine no matter ifUtilizing effector CD4 T cells prepared from cLNs to examine no matter whether these cells had been able…
L; incubated on ice for 1 h; Sigma), deoxycholate (2.eight mg/ml; incubated at 37 for 20 min; Fisher Scientific, Pittsburgh, PA), and DNase (four.five g/ml; incubated at space temperature for…
On, or no inclination.Table 1. Proximal composition and amino acids analysis (g/100g) from the diet plan. 5.1 Lipids eight.3 Ashes δ Opioid Receptor/DOR Antagonist Source Macronutrients (% 9.0 Moisture composition)…
Vents, decrease progression of atherosclerosis in CYP2 Inhibitor Storage & Stability coronary patients and decrease serum triglycerides. Among various varieties of CVD, ischemic heart illness, characterized by either underlying atherosclerosis…
Ow disappearance on the microparticles from mouse eyes that correlated wellOw disappearance from the microparticles from mouse eyes that correlated nicely with the duration of bioactivity (Figure 7).NIH-PA Author Manuscript…
Ratorias, CIBERES, Instituto de Salud Carlos III, Universidad de Valladolid, ValladolidRatorias, CIBERES, Instituto de Salud Carlos III, Universidad de Valladolid, Valladolid, EspaEdited by: Rodrigo Iturriaga, Pontificia Universidad Cat ica de…
Onducted in pharmaceutical drug trials for regulatory approval was utilized. A limitation of this clinical study study was the inability to establish irrespective of whether the null outcome clearly was…
The basic morphology of b2m fibrils was not impacted by PAK4 Inhibitor Synonyms incubation using the polyphenols for five min (see Fig. S2). EM photos, nevertheless, could not rule out…
Nt with all the observations in Figure two mercury exposure of B10.S mice resulted in significant increases inside the expression of IFNc, TNF-a, IL-1b, and NRLP3 (P 0.05) compared with…
Hat, irrespective of GSR, SCZ was connected with the identical relativeHat, irrespective of GSR, SCZ was linked together with the very same relative course of differences in contrast with HCS,…
Expression analyses suggested that ERL activates inflammatory processes and pathways whichExpression analyses suggested that ERL activates inflammatory processes and pathways which might be mediated by MyD88. Loss of MyD88 increases…
Ta not shown), suggesting that at least a few of the impact of PGN on IL-8 secretion in alveolar cells may possibly be post-transcriptional. Provided that PGN mediates its effects…
Rease affinity and selectivity for hCD22 more than other siglecs. To compare these analogues straight, a custom array containing 1, four, 12, 22, and 23, printed at one hundred M…
Ki et al., 2001). The proposed formulation was a gellan remedy containing calcium carbonate (as a source of Ca++ ions) and sodium citrate, which complexed the free of charge Ca++…
Lacing G7, V4, or E10. In contrast, replacement with the arginineLacing G7, V4, or E10. In contrast, replacement of your arginine 9 (R9) with 17 out in the 19 amino…
Ext page.)Ebert et al. Molecular Cancer 2014, 13:265 http:molecular-cancercontent131Page 7 ofExt web page.)Ebert et al. Molecular Cancer 2014, 13:265 http:molecular-cancercontent131Page 7 of(See figure on preceding page.) Figure three Cell viability…
Unctate staining was also visible in type II alveolar epithelial cells (figure 3E, F).DISCUSSION To our expertise, this study is among the initial to examine the differential response of main…
T the finish of 2009 . The genome assembly is in 12, 977 scaffolds, having a total scaffold length of 532.5 Mb. Ninety six NF-κB Inhibitor manufacturer percent on the…
Nerated spacer DNA sequence upstream in the minimal promoter region to serve as an insulating sequence between the plasmid sequence as well as the remaining promoter sequence (see Fig. S11…
Ntly enhanced by two PNU-120596 (solid vs. dashed linesNtly enhanced by 2 PNU-120596 (strong vs. dashed lines, Fig. 1G) from IC50(-PNU)=42.7 (Hill slope, 0.98) devoid of PNU-120596 to IC50(PNU)=12.2 (Hill…
D occulted type two diabetes inside the non-overweight group. Moreover, the impactD occulted type two diabetes inside the non-overweight group. Moreover, the impact of CPAP therapy could be diverse in…
E non-reducing terminal GalNAc(4-O-sulfate) linkage structure of CS was connected with an improved CXCR4 Formulation quantity of CS chains when the enzyme supply was among many complexes comprising any two…
Ble summarize the outcomes of 5 independent experiments after transfer of 1 to 106105 cells, with miR-29b -injected mice as filled symbols, and HBS-injected mice as empty symbols. The table…
Nitored by thin layer chromatography (TLC) carried out on 0.25 mm E. Merck silica plates (60F-254), utilizing UV light because the visualizing agent and an acidic resolution of p-anisaldehyde and…
On for effective power production. In contrast, in cancer cells, andOn for effective power production. In contrast, in cancer cells, and most likely other very proliferating cells, the influx of…
Pubertal improvement in girls a single year later . The outcomes from this well-powered study reported an elevated prevalence of stage 2+ breast/pubic hair improvement among girls with all the…
Maging (IncuCyte; Essens Bioscience, Birmingham, U.K.), as described previously . Cellular viability was also determined by MTS assay (3-5--2--2H-tetrazolium) (Promega), in line with the manufacturer's protocol. Expression in the proliferation…
Iology but also of cancer and developmental biology.Materials and methodsReagents Principal antibodies employed in this operate had been mouse anti?tubulin mAb (SigmaAldrich), rat anti?tubulin mAb (Abcam), mouse anti-HA mAb (Covance),…
He target cell type. By way of example, the AAV2 Y730F mutantHe target cell variety. For instance, the AAV2 Y730F mutant shows enhanced gene transfer intoa AAV2 S489A vector demonstrates…
Regulating gene expression and facilitating DNA replications. Not all potential MARsRegulating gene expression and facilitating DNA replications. Not all possible MARs are associated with all the nuclear matrix at all…
D DBP metabolite concentrations, even just after controlling for maternal IQ. These findings are constant with another study of 296 mother-child pairs from New York City that reported decreased physical…
E difficult to receive based on the place of your major tumor. Major tumor CD40 Activator Formulation biopsies are routinely utilized in the clinics to stratify sufferers and inform therapy…
Haviours (Vertes, 2006). The prominent function of the medial thalamic nuclei in multisensory integration and info relay may possibly α4β7 Antagonist Gene ID partake in setting the state of cortical…
Ry antifungal prophylaxis. As many confounding variables may influence the threatRy antifungal prophylaxis. As numerous confounding variables might influence the risk for breakthrough IFI independently in the kind of prophylaxis…
On for effective energy production. In contrast, in cancer cells, andOn for effective power production. In contrast, in cancer cells, and probably other highly proliferating cells, the influx of pyruvate…
Creased thrombin generation (Glutathione Peroxidase drug Freudenberger et al., 2009). Besides MPA, an additional synthetic gestagen, norethisterone acetate (NET-A), is generally utilized in postmenopausal HRT (Koubovec et al., 2005) together…
O employed to investigate the H1 Receptor Antagonist drug effect of interruptions from the Gly-Xaa-Yaa repeating sequence on triple-helix conformation, stability and folding (Hwang and Brodsky, 2012). Even though human…
Substitutions. We tested whether or not any of the 16 msh2 missense variants displayed a special spectrum of base-pair substitutions when in comparison with wildtype or the msh2 null. As…
Fter therapy of LPS-stimulated macrophages with the drug I-BET (forty), expression ofFter treatment method of LPS-stimulated macrophages with the drug I-BET (40), expression on the TNF- gene following L. monocytogenes…
Aginal tissues at 3 days p.c. (Fig. 7C) and eventually clearedAginal tissues at three days p.c. (Fig. 7C) and at some point cleared the virus from the vaginal CXCR4 Synonyms…
D and tissue collection Twenty-four hours right after the final dose was administered, the rats had been sacrificed by i.p. injection with 75 mg/kg pentobarbital, followed promptly by collection of…
Dard protein answer was mixed with 1.eight ml of distilled water and 2 ml of six H4 Receptor Modulator Compound sodium hydroxyde remedy. Then, 0.two ml with the Benedict's reagent…
A-dependent caspase pathway also as AIF and Endo G pathways is also discovered to contribute tothe induction of apoptosis by baicalein . Our final results also proved that cell death…
Autophagy by TOR signaling, autophagy has been shown to become neededAutophagy by TOR signaling, autophagy has been shown to be necessary for cellular overADAM17 Inhibitor Gene ID growth driven by…
On for efficient power production. In contrast, in cancer cells, andOn for Bak drug effective energy production. In contrast, in cancer cells, and probably other hugely proliferating cells, the influx…
Implicated this program within the pathogenesis of depression. Some achievable mechanisms of action contain relocalizing CB1 receptors (amongst the limbic system, the reward method and midbrain monoaminergic nuclei), modulating monoaminergic…
S when compared with manage beams soon after two wks of exposure (Fig 3b). 3.three Raloxifene alters strains transferred to HAP To investigate the mechanisms in the improve in material…
Es had been calculated for person RGs employing NormFinder that assessed the expression COX-1 Inhibitor Storage & Stability stability by combining estimated inter- and intra-group variation (Table 4). The genes…
Kin Elmer, Waltham, MA). Digital micrographs have been taken working with a NikonKin Elmer, Waltham, MA). Digital micrographs were taken employing a Nikon Inverted Scope Eclipse T-100 scope (Nikon Instruments,…
On of resistance to IM. Because the repair of DSBs byOn of resistance to IM. Since the repair of DSBs by ALT NHEJ is error-prone, resulting in substantial deletions and…
Ding to induced autophagosomes may be visualized and measured. Subsequent, we treated this cell line with unique PAMP ligands that engaged the identified TLRs and Cathepsin L Inhibitor Compound measured…
F DCTelomere Dysfunction due to RTEL1 Founder MutationAuthor SummaryPatients with dyskeratosisF DCTelomere Dysfunction as a result of RTEL1 Founder MutationAuthor SummaryPatients with dyskeratosis congenita (DC), a uncommon inherited disease, are…
Yntenous orthologs and divided this by the amount of shared orthologs.Yntenous orthologs and divided this by the number of shared orthologs. The Iplasma genome has the lowest synteny using the…
PErk than cells with typical BCR (19). We've got measured pErk by flow cytometry following treating immature B cells3?3Igi HSP90 Inhibitor review gene-targeted mice create B cells that express a…
Interactions in between a cell and its surroundings. Cell differentiation indicates theInteractions amongst a cell and its surroundings. Cell differentiation suggests the process in which reasonably unspecialized cells, e.g. embryonic…
S and against any screening in adults older than 85 years.8 InS and against any screening in adults older than 85 years.eight Inside the USPSTF suggestions for practice, physicians are…
Rch Laboratories, utilized at 1:200 or had been Alexa Fluor conjugates from Invitrogen/Molecular Probes utilized at 1:500?:750. For detection from the puc-lacZ reporter in adult fat physique, 3- to 4-day-old…
Entiation and memory formation . Also, RCAN1-1S overexpression within the hippocampal neuronal cell line HT22 cell line resulted in hyperphosphorylation of tau , which positions Rcan1 as a crucial candidate…
Tivity of PI3K, Ras, and Erk relative to nonstimulated cells. Certainly, prolonged BCR stimulation in immature B cells reduces levels of downstream effectors in the PI3K pathway relative to nonstimulated…
D for its ability to type self-assembled 5-HT6 Receptor Agonist Storage & Stability particles with SP6001. TheD for its capacity to form self-assembled particles with SP6001. The size in the…
Ubiquitin to its target proteins, termed ubiquitylation or ubiquitination, has variousUbiquitin to its target proteins, termed ubiquitylation or ubiquitination, has quite a few regulatory functions in eukaryotic cells. Proteome-wide mapping…
With the nanocomposite elevated as compared with that of polyaniline. TheIn the nanocomposite increased as compared with that of polyaniline. The addition of ZnO nanostructures in the polmer matric enhanced…
Eurons for electrophysiological patch-clamp experiments. Recordings were performed at area temperatureEurons for electrophysiological patch-clamp experiments. Recordings have been conducted at area temperature employing a Multiclamp-700B amplifier equipped with Digidata-1440A AD…
Ncer: c). doi:ten.1371/journal.pone.0093906.gFigure 11. Distribution of signature peaks of STAT5 manufacturer Gastric cancer and normal tissue. doi:ten.1371/journal.pone.0093906.gPLOS One particular | plosone.orgRaman Spectroscopy of Malignant Gastric MucosaTable 3. Distribution of Raman…
PARP7 Inhibitor review Tility . They result in membrane rupture by stimulatingPLOS 1 | plosone.orgthe ECM remodelling enzyme MMP-9, that in turn results in cell apoptosis and breakdown of collagen…
Ve Commons Attribution Non-Commercial License (creativecommons.org/licenses/by-nc/3.0) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original operate is adequately cited.Hwang et al.the cooking water. In the…
Iate given that the possibility of a variety I error isIate provided that the possibility of a type I error is significantly less problematic than a form II error in…
Igration is because of its decreased catalytic activity, we measured pyruvateIgration is on account of its decreased catalytic activity, we measured pyruvate and lactate concentration in LDH-A knocking down cells…
Hr202 and Tyr204 in its activation loop, web sites which might be dephosphorylated by numerous distinct phosphatases within precise cellular contexts(Patterson et al. 2009, Paul et al. 2003, Piserchio et…
Ortunities for escalating inhibitor selectivity.Aoyagi-Scharber et al.Acta Cryst. (2014). F70, 1143?BMNstructural communications4. DiscussionRecent efforts in PARP inhibitor design and style have certainly centered on targeting sequence-variable and/or structure-variable regions outside…
En ten s right after the addition of drug (Relative fluorescence (RF)initial) and once again after a period of 120 s (RFfinal). The RFfinal was subtracted in the RFinitial to…
Ealth, the Scholar of ``Dawn'' Program of Shanghai Education Commission, ShanghaiEalth, the Scholar of ``Dawn'' System of Shanghai Education Commission, Shanghai Outstanding Academic Leader, and the Shanghai Essential fundamental research…
Was demonstrated that, the price of glucose infusion necessary to keepWas demonstrated that, the rate of glucose infusion ROCK list essential to sustain glucose levels within a hyperinsulinemic-hypoglycemic clamp was…
R cardiovascular risk aspects: a meta-analysis and systematic assessment. Am J Clin Nutr. 2009;90:56?3. 21. Canales A, Benedi J, Nus M, Librelotto J, Sanchez-Montero JM, Sanchez-Muniz FJ. Impact of walnut-enriched…
Sion Here a major cardiac cell line was examined for its potential use to screen for cardiac metabolism elated liabilities. These ventricularcells are derived from adult humans, which is essential…
Lation of CD4+ T cells differentiation in schistosomiasis. Moreover, these novel findings imply that AQP4 could function as a new therapeutic target if it is actually directly involved in Th…
Placeholders (0.18 at .23eccentricity along the horizontal meridian. Following 500 ms, a targetPlaceholders (0.18 at .23eccentricity along the horizontal meridian. After 500 ms, a target array was presented for 75…
H they inhibit. The transition states of carboxylesters are tetrahedral, whilstH they inhibit. The transition states of carboxylesters are tetrahedral, although those of OP are pentavalent. Accommodation with the a…
On in each and every group. Graphs of both mean frequency-response and implyOn in each and every group. Graphs of each imply frequency-response and imply concentration-response information were constructed. In…
Ever working with sugammadex in their daily practice. Occasional use of sugammadexEver utilizing sugammadex in their everyday practice. Occasional use of sugammadex was reported in 21 from the respondents.The reversal…
Nt. All information are representative of at the very least 3 independent experimentsUseNt. All information are representative of at least three independent experimentsUse Committee, Tor Vergata University) committees. C57BL6 adult…