Name :
GDF6 (Human) Recombinant Protein
Biological Activity :
Human GDF6 (Q6KF10) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Q6KF10
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=392255
Amino Acid Sequence :
TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR.
Molecular Weight :
27.1
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
BMP-13 protein was lyophilized from a 0.2um filtered concentrated solution in 30% Acetonitrile and 0.1% TFA.
Applications :
Functional Study, SDS-PAGE,
Gene Name :
GDF6
Gene Alias :
BMP13, CDMP2, KFS, KFSL, MGC158100, MGC158101, SGM1
Gene Description :
growth differentiation factor 6
Gene Summary :
This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily of secreted signaling molecules. It is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene result in colobomata, which are congenital abnormalities in ocular development, and in Klippel-Feil syndrome (KFS), which is a congenital disorder of spinal segmentation. [provided by RefSeq
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SARS-CoV-2 Plpro site
FGF-1 ProteinStorage & Stability
Popular categories:
Cathepsin X/Cathepsin Z
KIR2DS3