Name :
IL10 (Human) Recombinant Protein

Biological Activity :
Human IL10 (P22301, 19 a.a. – 178 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of bioactivity analysis

Protein Accession No. :
P22301

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3586

Amino Acid Sequence :
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Weight :
19.4

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Viruses

Interspecies Antigen Sequence :

Preparation Method :
Baculovirus expression system

Purification :

Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.

Storage Buffer :
In Phosphate-Buffer Saline pH 7.4 (10% glycerol)

Applications :
Functional Study, SDS-PAGE,

Gene Name :
IL10

Gene Alias :
CSIF, IL-10, IL10A, MGC126450, MGC126451, TGIF

Gene Description :
interleukin 10

Gene Summary :
The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. [provided by RefSeq

Other Designations :
cytokine synthesis inhibitory factor

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SHH Proteinmedchemexpress
FSH Recombinant Proteins
Popular categories:
ALK-2/ACVR1
Ubiquitin-Specific Peptidase 39