Name :
SDHAF1 (Human) Recombinant Protein
Biological Activity :
Human SDHAF1 (NP_001036096, 1 a.a. – 115 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
A6NFY7
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=644096
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSMSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTGEPGGVGSQPDDGDSPRNPHDSTGAPETRPDGR
Molecular Weight :
15.2
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. SDS-PAGE analysis of SDHAF1 (Human) Recombinant Protein
Storage Buffer :
In PBS, pH 7.4 (0.1mM PMSF, 2 mM DTT, 30% glycerol).
Applications :
SDS-PAGE，
Gene Name :
LOC644096
Gene Alias :
–
Gene Description :
hypothetical protein LOC644096
Gene Summary :
The succinate dehydrogenase (SDH) complex, or complex II of the mitochondrial respiratory chain, is composed of 4 individual subunits (see SDHA, MIM 600857). SDHAF1 is essential for SDH assembly but does not physically associate with the complex in vivo (Ghezzi et al., 2009).[supplied by OMIM
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SARS-CoV-2 3C-like Protease web
IL-12 Recombinant Proteins
Popular categories:
ADAM15
DEP-1 Proteins