Name :
LEP (Human) Recombinant Protein
Biological Activity :
Human LEP (Q6NT58) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
Q6NT58
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3952
Amino Acid Sequence :
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Molecular Weight :
16
Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C or -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditionsLane 2: reducing conditions
Storage Buffer :
No additive
Applications :
Functional Study， SDS-PAGE，
Gene Name :
LEP
Gene Alias :
FLJ94114, OB, OBS
Gene Description :
leptin
Gene Summary :
This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq
Other Designations :
leptin (murine obesity homolog)|leptin (obesity homolog, mouse)|obese, mouse, homolog of|obesity factor
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MCP-1/CCL2 Proteinmanufacturer
CTGF MedChemExpress
Popular categories:
SARS-CoV-2 S1 Protein NTD
IL-12R beta 1